Recombinant Bovine Butyrophilin Subfamily 1 Member A1 (BTN1A1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00378P
Greater than 85% as determined by SDS-PAGE.
Recombinant Bovine Butyrophilin Subfamily 1 Member A1 (BTN1A1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00378P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bovine Butyrophilin Subfamily 1 Member A1 (BTN1A1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P18892 |
Target Symbol | BTN1A1 |
Species | Bos taurus (Bovine) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | APFDVIGPQEPILAVVGEDAELPCRLSPNVSAKGMELRWFREKVSPAVFVSREGQEQEGEEMAEYRGRVSLVEDHIAEGSVAVRIQEVKASDDGEYRCFFRQDENYEEAIVHLKVAALGSDPHISMKVQESGEIQLECTSVGWYPEPQVQWRTHRGEEFPSMSESRNPDEEGLFTVRASVIIRDSSMKNVSCCIRNLLLGQEKEVEVSIPASFFPR |
Expression Range | 27-242aa |
Protein Length | Partial |
Mol. Weight | 31.8 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May function in the secretion of milk-fat droplets. May act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, BTN/MOG family |
Database References | KEGG: bta:107131748 UniGene: Bt.59359 |
Tissue Specificity | Expressed in mammary tissue. |
Gene Functions References
- BTN present in milk and dairy products may influence the composition and function of myelin oligodendrocyte glycoprotein (MOG)-specific autoimmune repertoire during the course of multiple sclerosis. PMID: 14688379