Recombinant Bovine Angiogenin-1 (ANG1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08279P
Greater than 90% as determined by SDS-PAGE.
Recombinant Bovine Angiogenin-1 (ANG1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08279P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bovine Angiogenin-1 (ANG1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P10152 |
| Target Symbol | ANG1 |
| Synonyms | ANG1; ANGAngiogenin-1; EC 3.1.27.- |
| Species | Bos taurus (Bovine) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMKNRRLTRPCKDRNTFIHGNKNDIKAICEDRNGQPYRGDLRISKSEFQITICKHKGGSSRPPCRYGATEDSRVIVVGCENGLPVHFDESFITPRH |
| Expression Range | 24-148aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 18.6kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Has very low ribonuclease activity. |
| Subcellular Location | Cytoplasmic vesicle, secretory vesicle lumen. Secreted. Nucleus, nucleolus. |
| Protein Families | Pancreatic ribonuclease family |
| Database References | STRING: 9913.ENSBTAP00000026126 UniGene: Bt.12722 |
| Tissue Specificity | Serum and milk. |
