Recombinant Bovine Agouti-Signaling Protein (ASIP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04992P

Greater than 85% as determined by SDS-PAGE.
Recombinant Bovine Agouti-Signaling Protein (ASIP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04992P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bovine Agouti-Signaling Protein (ASIP) Protein (His) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q29414 |
Target Symbol | ASIP |
Synonyms | ASIP; Agouti-signaling protein; ASP; Agouti switch protein |
Species | Bos taurus (Bovine) |
Expression System | Baculovirus |
Tag | N-10His |
Target Protein Sequence | HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC |
Expression Range | 23-133aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 14.9 |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). |
Subcellular Location | Secreted. |
Database References | KEGG: bta:404192 STRING: 9913.ENSBTAP00000045382 UniGene: PMID: 22530003 |