Recombinant Bovine Adrenodoxin, Mitochondrial (FDX1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10757P
Greater than 85% as determined by SDS-PAGE.
Recombinant Bovine Adrenodoxin, Mitochondrial (FDX1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10757P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bovine Adrenodoxin, Mitochondrial (FDX1) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P00257 |
| Target Symbol | FDX1 |
| Synonyms | FDX1; ADX; Adrenodoxin; mitochondrial; Adrenal ferredoxin; Ferredoxin-1; Hepato-ferredoxin |
| Species | Bos taurus (Bovine) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE |
| Expression Range | 59-186aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 15.3 kDa |
| Research Area | Metabolism |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons. |
| Subcellular Location | Mitochondrion matrix. |
| Protein Families | Adrenodoxin/putidaredoxin family |
| Database References | KEGG: bta:281157 STRING: 9913.ENSBTAP00000015660 UniGene: PMID: 25858110 |
