Recombinant Bottlenose dolphin IL8 Protein
Beta LifeScience
SKU/CAT #: BLA-0226P
Recombinant Bottlenose dolphin IL8 Protein
Beta LifeScience
SKU/CAT #: BLA-0226P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Bottlenose dolphin |
Accession | Q7YRB5 |
Synonym | (Ala-IL-8)77 (Ser-IL-8)72 9E3 Beta thromboglobulin like protein C-X-C motif chemokine 8 CEF-4 chemokine, CXC motif, ligand 8 CXCL8 Emoctakin GCP-1 GCP/IL-8 protein I GCP/IL-8 protein II GCP/IL-8 protein III GCP/IL-8 protein IV GCP/IL-8 protein V GCP/IL-8 protein VI GCP1 Granulocyte chemotactic protein 1 IL-8 IL-8(1-77) IL-8(9-77) IL8 IL8/NAP1 form I IL8/NAP1 form II IL8/NAP1 form III IL8/NAP1 form IV IL8/NAP1 form V IL8/NAP1 form VI IL8_HUMAN Inteleukin 8 LECT LUCT Lymphocyte-derived neutrophil-activating factor LYNAP MDNCF MDNCF-b MDNCF-c MONAP Monocyte derived neutrophil activating peptide Monocyte derived neutrophil chemotactic factor Monocyte-derived neutrophil chemotactic factor Monocyte-derived neutrophil-activating peptide NAF NAP 1 NAP-1 NAP1 Neutrophil activating peptide 1 Neutrophil activating protein 1 Neutrophil-activating factor Neutrophil-activating protein 1 Protein 3 10C Protein 3-10C SCYB 8 SCYB8 Small inducible cytokine subfamily B member 8 T cell chemotactic factor T-cell chemotactic factor TSG 1 TSG1 |
Description | Recombinant Bottlenose dolphin IL8 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | AVLSRMTSELRCQCINIHSTPFHPKFIRELRVIESGPHCENSEIIVKLVN GKEVCLNPKEKWVQKVVQIFLKRAEKKDP |
Molecular Weight | 9 kDa |
Purity | >95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |