Recombinant Bothrops Leucurus Snake Venom Metalloproteinase Leucurolysin-A (LEUC-A) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04936P
Greater than 85% as determined by SDS-PAGE.
Recombinant Bothrops Leucurus Snake Venom Metalloproteinase Leucurolysin-A (LEUC-A) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04936P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bothrops Leucurus Snake Venom Metalloproteinase Leucurolysin-A (LEUC-A) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P84907 |
| Target Symbol | P84907 |
| Synonyms | ; Snake venom metalloproteinase leucurolysin-A; Leuc-A; SVMP; EC 3.4.24.- |
| Species | Bothrops leucurus (Whitetail lancehead) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | QQFSPRYIELVVVADHGMFKKYNSNLNTIRKWVHEMLNTVNGFFRSMNVDASLVNLEVWSKKDLIKVEKDSSKTLTSFGEWRERDLLPRISHDHAQLLTVIFLDEETIGIAYTAGMCDLSQSVAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQCHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP |
| Expression Range | 1-202aa |
| Protein Length | Full Length |
| Mol. Weight | 30.5 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Non-hemorrhagic metalloproteinase that hydrolyzes the alpha chains of fibrinogen, as well as fibrin, fibronectin and casein. Beta and gamma chains are also hydrolyzed, but more slowly. Thrombolytic activity is also observed. Induces detachment of endothelial cells followed by death, and inhibits endothelial cell adhesion to fibronectin. Induces edema in mouse paw. Inhibits ADP-induced platelet aggregation on human platelet-rich plasma with an IC(50) of 2.8 uM. |
| Subcellular Location | Secreted. |
| Protein Families | Venom metalloproteinase (M12B) family, P-I subfamily |
| Tissue Specificity | Expressed by the venom gland. |
