Recombinant Bordetella Pertussis Serotype 3 Fimbrial Subunit (FIM3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10612P
Greater than 85% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) fim3.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) fim3.
Recombinant Bordetella Pertussis Serotype 3 Fimbrial Subunit (FIM3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10612P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bordetella Pertussis Serotype 3 Fimbrial Subunit (FIM3) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P17835 |
| Target Symbol | FIM3 |
| Synonyms | fim3; BP1568; Serotype 3 fimbrial subunit |
| Species | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP |
| Expression Range | 26-204aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 21.2 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process. |
| Subcellular Location | Fimbrium. Note=Pili structure on the cell surface. |
| Protein Families | Fimbrial protein family |
| Database References | KEGG: bpe:BP1568 STRING: 257313.BP1568 |
