Recombinant Bordetella Pertussis Pertactin Autotransporter (PRN) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03085P
Greater than 90% as determined by SDS-PAGE.
Recombinant Bordetella Pertussis Pertactin Autotransporter (PRN) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03085P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bordetella Pertussis Pertactin Autotransporter (PRN) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P14283 |
| Target Symbol | PRN |
| Synonyms | prn; omp69A; BP1054; Pertactin autotransporter; P.93) [Cleaved into: Outer membrane protein P.69; Pertactin translocator] |
| Species | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW |
| Expression Range | 632-910aa |
| Protein Length | Partial |
| Mol. Weight | 45.8kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough. |
| Subcellular Location | [Pertactin autotransporter]: Periplasm.; [Outer membrane protein P.69]: Secreted. Cell surface.; [Pertactin translocator]: Cell outer membrane; Multi-pass membrane protein. Note=The cleaved C-terminal fragment (autotransporter domain) is localized in the outer membrane. |
| Database References | KEGG: bpe:BP1054 STRING: 257313.BP1054 |
Gene Functions References
- Prn-KO strains induced an increased production of pro-inflammatory cytokines by human and murine dendritic cell. PMID: 29559630
- Multiple driving forces required for efficient secretion of autotransporter virulence proteins, such as pertactin. PMID: 25670852
- Results indicate that the purified pertactin is a potential candidate as immunogen for preparation of diagnostic reagents and as a vaccine component. PMID: 20306653
