Recombinant Bombyx Mori Prothoracicotropic Hormone (PTTH) Protein (His)

Name: Recombinant Bombyx Mori Prothoracicotropic Hormone (PTTH) Protein (His)
Brand: Beta LifeScience
SKU: BLC-09791P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Bombyx Mori Prothoracicotropic Hormone (PTTH) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P17219
Target Symbol	P17219
Synonyms	; Prothoracicotropic hormone; PTTH) [Cleaved into: P2K; P6K; Prothoracicotropic hormone]
Species	BOMMO(Silk moth)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN
Expression Range	116-224aa
Protein Length	Full Length of Mature Protein
Mol. Weight	16.7kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.; Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions.
Database References	KEGG: bmor:692767 UniGene: Bmo.125
Tissue Specificity	PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain.

Gene Functions References

HR38 is a prothoracicotropic hormone(PTTH)-stimulated immediate early gene that is, at least in part, induced through Ca(2+)/ERK and PI3K signaling. The present study proposes a potential cross talk mechanism between PTTH and ecdysone signaling to regulate insect development and lays a foundation for a better understanding of the mechanisms of PTTH's actions. PMID: 27090809
There are interconnections among Ca(2+) signaling, adenosine 5'-monophosphate-activated protein kinase, and 4E-BP phosphorylation in in prothoracicotropic hormone (PTTH-activated prothoracic glands of Bombyx mori. PMID: 27751888
Study reports the physical basis of neurohormone PTTH sensing by the receptor tyrosine kinase Torso. Hormone binding by Torso is asymmetric and anticooperative, allowing receptor levels to determine the nature of signal transduction. PMID: 26698662
To examine the expression of Rab proteins and neuropeptide hormones in the brain of the silkworm, Bombyx mori.The Rab1 co-localized with prothoracicotropic hormone. PMID: 22922733
PTTH/PI3K/TOR/4E-BP (S6K) signaling is involved in PTTH-stimulated ecdysteroidogenesis by prothoracic glands. PMID: 22227406
The authors showed that Bombyx mori prothoracicotropic hormone (PTTH)-stimulated ecdysteroidogenesis was partially blocked by LY294002 and wortmannin, indicating that phosphoinositide 3-kinase (PI3K) is involved in PTTH-stimulated ecdysteroidogenesis. PMID: 21199670
Study showed that prothoracicotropic hormone (PTTH) stimulates a rapid increase in tyrosine phosphorylation of at least 2 proteins in prothoracic glands: extracellular signal-regulated kinase and a 120-kDa protein. PMID: 20568296
the TATA box is involved in regulation of PTTH gene expression in B. mori PMID: 20563654
PTTH-stimulated ERK phosphorylation is only partially Ca(2+)- and calmodulin-dependent, and HNMPA-(AM)(3)-sensitive receptor tyrosine kinase is involved in activation of ERK phosphorylation by PTTH. PMID: 19800889

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.