Recombinant Bacillus Subtilis S-Ribosylhomocysteine Lyase (LUXS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08945P

Greater than 90% as determined by SDS-PAGE.
Recombinant Bacillus Subtilis S-Ribosylhomocysteine Lyase (LUXS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08945P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bacillus Subtilis S-Ribosylhomocysteine Lyase (LUXS) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O34667 |
Target Symbol | LUXS |
Synonyms | luxS; ytjB; BSU30670; S-ribosylhomocysteine lyase; EC 4.4.1.21; AI-2 synthesis protein; Autoinducer-2 production protein LuxS |
Species | Bacillus subtilis (strain 168) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG |
Expression Range | 1-157aa |
Protein Length | Full Length |
Mol. Weight | 21.7kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the environment. The regulation of gene expression in response to changes in cell density is called quorum sensing. Catalyzes the transformation of S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD). |
Protein Families | LuxS family |
Database References | KEGG: bsu:BSU30670 STRING: 224308.Bsubs1_010100016691 |
Gene Functions References
- Structural study of catalytically inactive mutant (Cys84Ala) of cobalt (Co2+)-substituted Bacillus subtilis LuxS in complex with the 2-ketone intermediate provides strong support for the proposed Lewis acid function of the metal ion during catalysis. PMID: 15751951
- B. subtilis luxS is a growth-phase-regulated gene that produces active AI-2 able to mediate the interspecific activation of light. PMID: 16740951