Recombinant Bacillus Subtilis Probable Flavodoxin-2 (YKUP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10116P

Greater than 90% as determined by SDS-PAGE.
Recombinant Bacillus Subtilis Probable Flavodoxin-2 (YKUP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10116P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bacillus Subtilis Probable Flavodoxin-2 (YKUP) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O34589 |
Target Symbol | YKUP |
Synonyms | ykuP; BSU14170; Probable flavodoxin 2 |
Species | Bacillus subtilis (strain 168) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MAKILLVYATMSGNTEAMADLIEKGLQEALAEVDRFEAMDIDDAQLFTDYDHVIMGTYTWGDGDLPDEFLDLVEDMEEIDFSGKTCAVFGSGDTAYEFFCGAVDTLEAKIKERGGDIVLPSVKIENNPEGEEEEELINFGRQFAKKSGCAV |
Expression Range | 1-151aa |
Protein Length | Full Length |
Mol. Weight | 32.6kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Low-potential electron donor to a number of redox enzymes. |
Protein Families | Flavodoxin family |
Database References | KEGG: bsu:BSU14170 STRING: 224308.Bsubs1_010100007871 |
Gene Functions References
- Ability of YkuP to transfer electrons toward cytochrome P450 monooxygenase CYP109B1 (Gene ID 936452)from B. subtilis is reproted PMID: 20186410
- Flavodoxins YkuP and YkuN from B. subtilis are shown to support oxidizing activity of cytochrome P450 monooxygenase CYP109B1 (GeneBanK CAB13078) from same organism. PMID: 20186410
- Interaction of YkuP with cytochrome P450 monooxygenase CYP109B1 from Bacillus subtilis 168 is reported. PMID: 20186410
- Cloning, expression, purification, and characterization of the flavin mononucleotide(FMN)-binding flavodoxin YkuP is reported. PMID: 15449930