Recombinant Bacillus Subtilis Penicillin-Binding Protein 4 (PBPE) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02686P
Greater than 90% as determined by SDS-PAGE.
Recombinant Bacillus Subtilis Penicillin-Binding Protein 4 (PBPE) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02686P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bacillus Subtilis Penicillin-Binding Protein 4 (PBPE) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P32959 |
| Target Symbol | PBPE |
| Synonyms | pbpE; BSU34440; Penicillin-binding protein 4*; PBP 4*; PBP 4A; Penicillin-binding protein E |
| Species | Bacillus subtilis (strain 168) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK |
| Expression Range | 1-451aa |
| Protein Length | Full Length |
| Mol. Weight | 67.4kDa |
| Research Area | Microbiology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Probably involved in peptidoglycan modification during cortex synthesis. |
| Subcellular Location | Forespore outer membrane; Peripheral membrane protein. |
| Protein Families | Beta-lactamase family |
| Database References | KEGG: bsu:BSU34440 STRING: 224308.Bsubs1_010100018661 |
Gene Functions References
- PBP4* has murein hydrolyze activity. Peptidoglycan is modified in response to high salt and that PBP4* contributes to this modification. PMID: 19063962
