Recombinant Bacillus Subtilis 4'-Phosphopantetheinyl Transferase Ffp (FFP) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04903P
Greater than 85% as determined by SDS-PAGE.
Recombinant Bacillus Subtilis 4'-Phosphopantetheinyl Transferase Ffp (FFP) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04903P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bacillus Subtilis 4'-Phosphopantetheinyl Transferase Ffp (FFP) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9F4F7 |
| Target Symbol | FFP |
| Synonyms | ffp; sfp4'-phosphopantetheinyl transferase ffp; EC 2.7.8.-; Fengycin synthase-activating enzyme |
| Species | Bacillus subtilis |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MKIYGIYMDRPLSQEETDRLMSFVSAEKREKCRRFYHKEDAHRTLLGDVLVRSVISEQYQLNKADIRFSAQEYGKPCIPDLPNAHFNISHSGHWVIGAFDSDPIGVDIEKMKPISLGIAERFFSKNEYSDLLSKHKDEQNDYFYHLWSMKESFIKQEGKGLSLPLDSFSVRLHEDGRVSVELPEHHTPCFIKTYEVDPGYKMAVCAARPDFPEDITMISYEALL |
| Expression Range | 1-224aa |
| Protein Length | Full Length |
| Mol. Weight | 31.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May activate the peptidyl carrier protein (PCP) domains of fengycin synthase by transferring the 4'-phosphopantetheinyl moiety of coenzyme A (CoA) to a serine residue. |
| Protein Families | P-Pant transferase superfamily, Gsp/Sfp/HetI/AcpT family |
