Recombinant Arabidopsis Thaliana Sucrose-Phosphate Synthase 1 (SPS1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09483P

Greater than 90% as determined by SDS-PAGE.
Recombinant Arabidopsis Thaliana Sucrose-Phosphate Synthase 1 (SPS1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09483P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Arabidopsis Thaliana Sucrose-Phosphate Synthase 1 (SPS1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q94BT0 |
Target Symbol | SPS1 |
Synonyms | SPS1; SPSA1; At5g20280; F5O24.170; Sucrose-phosphate synthase 1; EC 2.4.1.14; Sucrose-phosphate synthase 1F; AtSPS1F; Sucrose-phosphate synthase 5.1; AtSPS5.1; UDP-glucose-fructose-phosphate glucosyltransferase |
Species | Arabidopsis thaliana (Mouse-ear cress) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | VVIALDFDGEEDTLEATKRILDAVEKERAEGSVGFILSTSLTISEVQSFLVSGGLNPNDFDAFICNSGSDLHYTSLNNEDGPFVVDFYYHSHIEYRWGGEGLRKTLIRWASSLNEKKADNDEQIVTLAEHLSTDYCYTFTVKKPAAVPPVRELRKLLRIQALRCHVVYSQNGTRINVIPVLASRIQALRYLFVRWGIDMAKMAVFVGESGDTDYEGLLGGLHKSVVLK |
Expression Range | 768-995aa |
Protein Length | Partial |
Mol. Weight | 41.5kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation. Required for nectar secretion. |
Protein Families | Glycosyltransferase 1 family |
Database References | KEGG: ath:AT5G20280 STRING: 3702.AT5G20280.1 UniGene: PMID: 24924143 |