Recombinant Arabidopsis Thaliana Rrna 2-O-Methyltransferase Fibrillarin 1 (MED36B) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08727P
Greater than 90% as determined by SDS-PAGE.
Recombinant Arabidopsis Thaliana Rrna 2-O-Methyltransferase Fibrillarin 1 (MED36B) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08727P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Arabidopsis Thaliana Rrna 2-O-Methyltransferase Fibrillarin 1 (MED36B) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9FEF8 |
| Target Symbol | MED36B |
| Synonyms | FIB1; FBR1; MED36_2; MED36B; SKIP7; At5g52470; K24M7.22rRNA 2'-O-methyltransferase fibrillarin 1; AtFbr1; AtFib1; EC 2.1.1.-; Fibrillarin-like protein 1; Histone-glutamine methyltransferase; SKP1-interacting partner 7 |
| Species | Arabidopsis thaliana (Mouse-ear cress) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MRPPVTGGRGGGGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGRGRGAPRGRGGPPRGGMKGGSKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASFFLKTGGHFVISIKANCIDSTVAAEAVFQSEVKKLQQEQFKPAEQVTLEPFERDHACVVGGYRMPKKQKTPAS |
| Expression Range | 1-308aa |
| Protein Length | Full Length |
| Mol. Weight | 48.8kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | S-adenosyl-L-methionine-dependent methyltransferase that has the ability to methylate both RNAs and proteins (Probable). Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA (Probable). Site specificity is provided by a guide RNA that base pairs with the substrate (Probable). Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA (Probable). Also acts as a protein methyltransferase by mediating methylation of 'Gln-105' of histone H2A (H2AQ105me), a modification that impairs binding of the FACT complex and is specifically present at 35S ribosomal DNA locus. Binds monophosphate phosphoinositides in vitro. |
| Subcellular Location | Nucleus, nucleolus. |
| Protein Families | Methyltransferase superfamily, Fibrillarin family |
| Database References | |
| Tissue Specificity | Expressed in roots, leaves and flowers. Expressed in stems. |
