Recombinant Arabidopsis Thaliana Histone Deacetylase Hdt2 (HDT2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08848P

Greater than 90% as determined by SDS-PAGE.
Recombinant Arabidopsis Thaliana Histone Deacetylase Hdt2 (HDT2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08848P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Arabidopsis Thaliana Histone Deacetylase Hdt2 (HDT2) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q56WH4 |
Target Symbol | HDT2 |
Synonyms | HDT2; HD2; HD2B; HDA4; At5g22650; MDJ22.7Histone deacetylase HDT2; HD-tuins protein 2; Histone deacetylase 2b |
Species | Arabidopsis thaliana (Mouse-ear cress) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA |
Expression Range | 1-306aa |
Protein Length | Full Length |
Mol. Weight | 37.3kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. |
Subcellular Location | Nucleus, nucleolus. Nucleus. |
Protein Families | Histone deacetylase HD2 family |
Database References | KEGG: ath:AT5G22650 STRING: 3702.AT5G22650.1 UniGene: PMID: 23464703 |