Recombinant Arabidopsis Thaliana Epidermal Patterning Factor-Like Protein 9 (EPFL9) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04806P

Greater than 85% as determined by SDS-PAGE.
Recombinant Arabidopsis Thaliana Epidermal Patterning Factor-Like Protein 9 (EPFL9) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04806P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Arabidopsis Thaliana Epidermal Patterning Factor-Like Protein 9 (EPFL9) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9SV72 |
Target Symbol | EPFL9 |
Synonyms | EPFL9; STOMAGEN; At4g12970; F25G13.60EPIDERMAL PATTERNING FACTOR-like protein 9; EPF-like protein 9) [Cleaved into: Stomagen] |
Species | Arabidopsis thaliana (Mouse-ear cress) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR |
Expression Range | 32-102aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 14.2 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1). |
Subcellular Location | Secreted, extracellular space, apoplast. Secreted. |
Protein Families | Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily |
Database References | KEGG: ath:AT4G12970 STRING: 3702.AT4G12970.1 UniGene: PMID: 26002974 |