Recombinant Arabidopsis Thaliana E3 Sumo-Protein Ligase Siz1 (SIZ1) Protein (His)

Name: Recombinant Arabidopsis Thaliana E3 Sumo-Protein Ligase Siz1 (SIZ1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-01845P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Arabidopsis Thaliana E3 Sumo-Protein Ligase Siz1 (SIZ1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q680Q4
Target Symbol	SIZ1
Synonyms	E3 SUMO-protein transferase SIZ1
Species	Arabidopsis thaliana (Mouse-ear cress)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTVAKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNSLETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRAD
Expression Range	1-171aa
Protein Length	Partial
Mol. Weight	23.2 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	E3 SUMO protein ligase involved in regulation processes. Mediates SUMO/ attachment to PHR1, a MYB transcriptional activator controlling the phosphate deficiency responses. Functions as an upstream negative regulator of salicylic acid (SA) accumulation and subsequent SA-mediated systemic acquired resistance (SAR) signaling. Probably not involved in jasmonic acid (JA)-mediated defense response. Participates in abiotic stress-induced sumoylation. Controls heat shock-induced SUMO1 and SUMO2 conjugation and facilitates basal thermotolerance. Involved in freezing tolerance by mediating sumoylation of ICE1, a transcription activator of the cold signaling regulator CBF3/DREB1A. Acts as positive regulator of drought stress tolerance. Acts as floral repressor that promotes FLC expression by repressing FLD activity through sumoylation. Acts as negative regulator of abscisic acid (ABA) signaling through ABI5 sumoylation. Mediates sumoylation of SCE1, GTE3 and GTE5. Functions as negative regulator of SnRK1 signaling through sumoylation of several components of the SnRK1 complex.
Subcellular Location	Nucleus speckle.
Protein Families	PIAS family
Database References	KEGG: ath:AT5G60410 STRING: 3702.AT5G60410.2 UniGene: PMID: 29662028 SIZ1 suppresses an SNC1-dependent resistance response at both normal and high temperatures. At the same time, SIZ1 amplifies the dark and high temperature growth response, likely via COP1 and upstream of gene regulation by PIF4 and BRZ1. PMID: 29357355 The SnRK1 complex is SUMOylated on multiple subunits and identify SIZ1 as the E3 Small Ubiquitin-like Modifier (SUMO) ligase responsible for this modification. PMID: 26662259 regulates seed dormancy and germination PMID: 27130140 SUMO-conjugated proteins accumulate in response to high doses of sugar in a SIZ1-dependent manner. PMID: 26468507 The methylation level of the Arabidopsis genome, including transposons, was significantly lower in the siz1-2 mutant than in wild-type plants. CMT3 was sumoylated by the E3 ligase activity of AtSIZ1 through a direct interaction. PMID: 26398805 negatively affects stomatal closure and drought tolerance through accumulation of salicylic acid PMID: 22963672 This study establishes that the diverse properties characteristic of SIZ1 are associated with specific domains and that they can be separated. PMID: 20404572 The AtSIZ1 mutation is correlated with an overall decrease in alternative respiration and with a low carbohydrate content to maintain the carbon to nitrogen ratio in siz1-2 mutants. PMID: 22732219 SIZ1 sustains the stability and normal function of the mature female gametophyte which is necessary for pollen tube guidance. PMID: 22253727 The expression and enzymatic activity of Cu/ZnSOD1 (CSD1) in shoots of the siz1 mutant under excess Cu, was examined. PMID: 21897129 These data suggest that SIZ1-mediated sumoylation is involved specifically in copper homeostasis and tolerance in planta. PMID: 21632972 AtSIZ1 positively controls nitrogen assimilation by promoting sumoylation of nitrate reductases in Arabidopsis. PMID: 21772271 SIZ1 facilitates the auxin-regulated root architecture remodeling that occurs in response to Pi deficiency. PMID: 21156857 The salicylic acid-accumulating mutant siz1 exhibits sensitivity to chilling and freezing conditions. PMID: 19959255 These results indicate that SIZ1 regulates cell growth and plant development with regulation of salicylic acid accumulation. PMID: 20007967 The various domains of SIZ1 make unique contributions to the plant's ability to cope with its environment. PMID: 19837819 SIZ1 and sumoylation facilitate basal thermotolerance through processes that are salicylic acid independent. PMID: 17041025 SIZ1 is required for salicylic acid and PAD4-mediated R gene signalling, which in turn confers innate immunity in Arabidopsis.[SIZ1] PMID: 17163880 SIZ1 is a SUMO E3 ligase that facilitates conjugation of SUMO to protein substrates. PMID: 17416732 SIZ1 regulates Arabidopsis growth and that this SUMO E3 ligase plays a role in drought stress response likely through the regulation of gene expression. PMID: 17905899 Results suggest that SIZ1 is a floral repressor that not only represses the SA-dependent pathway, but also promotes FLC expression by repressing FLD activity through sumoylation, which is required for full FLC expression in a FRIGIDA background. PMID: 18069938

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.