Recombinant Arabidopsis Thaliana Beta-Amylase 3, Chloroplastic (BAM3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05011P

Greater than 85% as determined by SDS-PAGE.
Recombinant Arabidopsis Thaliana Beta-Amylase 3, Chloroplastic (BAM3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05011P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Arabidopsis Thaliana Beta-Amylase 3, Chloroplastic (BAM3) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O23553 |
Target Symbol | BAM3 |
Synonyms | BAM3; BMY8; CTBMY; At4g17090; dl4575c; FCAALL.5Beta-amylase 3; chloroplastic; EC 3.2.1.2; 1,4-alpha-D-glucan maltohydrolase; Beta-amylase 8; Chloroplast beta-amylase; CT-BMY |
Species | Arabidopsis thaliana (Mouse-ear cress) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | EMKFTHEKTFTPEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAENVEEAALV |
Expression Range | 50-548aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 59.4 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Beta-amylase activity. No alpha-amylase activity. Involved in cold resistance. Mediates the accumulation of maltose upon freezing stress, thus contributing to the protection of the photosynthetic electron transport chain. Plays a role in the circadian-regulated starch degradation and maltose metabolism in chloroplasts, especially at night. More active on phosphorylated glucan. Interacts directly with starch or other alpha-1,4-glucan. |
Subcellular Location | Plastid, chloroplast. |
Protein Families | Glycosyl hydrolase 14 family |
Database References |