Recombinant Anaplasma Phagocytophilum 50S Ribosomal Protein L22 (RPLV) Protein (His&MYC)
Beta LifeScience
SKU/CAT #: BLC-02541P
Greater than 90% as determined by SDS-PAGE.
Recombinant Anaplasma Phagocytophilum 50S Ribosomal Protein L22 (RPLV) Protein (His&MYC)
Beta LifeScience
SKU/CAT #: BLC-02541P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Anaplasma Phagocytophilum 50S Ribosomal Protein L22 (RPLV) Protein (His&MYC) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q2GL54 |
| Target Symbol | RPLV |
| Synonyms | rplV; APH_0285; 50S ribosomal protein L22 |
| Species | Anaplasma phagocytophilum (strain HZ) |
| Expression System | E.coli |
| Tag | N-10His&C-MYC |
| Target Protein Sequence | MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER |
| Expression Range | 1-112aa |
| Protein Length | Full Length |
| Mol. Weight | 17.2kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome.; The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome. |
| Protein Families | Universal ribosomal protein uL22 family |
| Database References | KEGG: aph:APH_0285 STRING: 212042.APH_0285 |
