Recombinant African Cassava Mosaic Virus Replication-Associated Protein (AC1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09645P
Greater than 90% as determined by SDS-PAGE.
Recombinant African Cassava Mosaic Virus Replication-Associated Protein (AC1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09645P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant African Cassava Mosaic Virus Replication-Associated Protein (AC1) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P14982 |
| Target Symbol | AC1 |
| Synonyms | AC1; AL1; Replication-associated protein; Rep; EC 2.7.7.-; EC 3.1.21.-; 40.4 kDa protein; Protein AC1; Protein AL1 |
| Species | African cassava mosaic virus (isolate West Kenyan 844) (ACMV) (Cassava latent virus (isolate West Kenyan 844)) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MRTPRFRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPKFIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSCSTSFHPNIQGAKSSSDVKSYLDKDGDTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADNVRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYLKHFKEFMGSQRDWQSNTKYGKPVQIKGGIPTIFLCNPGPTSSYKEFLAEEKQEALKAWALKNAIFITLTEPLYSGSNQSHSQTSQEASHPA |
| Expression Range | 1-358aa |
| Protein Length | Full Length |
| Mol. Weight | 42.3kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities. |
| Subcellular Location | Host nucleus. |
| Protein Families | Geminiviridae Rep protein family |
