Recombinant Actinia Equina Delta-Actitoxin-Aeq1A (DELTA-AITX-AEQ1A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04949P
Greater than 85% as determined by SDS-PAGE.
Recombinant Actinia Equina Delta-Actitoxin-Aeq1A (DELTA-AITX-AEQ1A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04949P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Actinia Equina Delta-Actitoxin-Aeq1A (DELTA-AITX-AEQ1A) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P61914 |
| Target Symbol | P61914 |
| Synonyms | DELTA-actitoxin-Aeq1a; DELTA-AITX-Aeq1a; Equinatoxin II; EqT II; EqTII; Equinatoxin-2 |
| Species | Actinia equina (Beadlet anemone) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | SADVAGAVIDGASLSFDILKTVLEALGNVKRKIAVGVDNESGKTWTALNTYFRSGTSDIVLPHKVPHGKALLYNGQKDRGPVATGAVGVLAYLMSDGNTLAVLFSVPYDYNWYSNWWNVRIYKGKRRADQRMYEELYYNLSPFRGDNGWHTRNLGYGLKSRGFMNSSGHAILEIHVSKA |
| Expression Range | 36-214aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 23.9 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Pore-forming protein that forms cations-selective hydrophilic pores of around 1 nm and causes cardiac stimulation and hemolysis. Pore formation is a multi-step process that involves specific recognition of membrane sphingomyelin (but neither cholesterol nor phosphatidylcholine) using aromatic rich region and adjacent phosphocholine (POC) binding site, firm binding to the membrane (mainly driven by hydrophobic interactions) accompanied by the transfer of the N-terminal region to the lipid-water interface and finally pore formation after oligomerization of monomers. Cytolytic effects include red blood cells hemolysis, platelet aggregation and lysis, cytotoxic and cytostatic effects on fibroblasts. Lethality in mammals has been ascribed to severe vasospasm of coronary vessels, cardiac arrhythmia, and inotropic effects. |
| Subcellular Location | Secreted. Nematocyst. Target cell membrane. Note=Forms an alpha-helical membrane channel in the prey. |
| Protein Families | Actinoporin family, Sea anemone subfamily |
