Native Human Collagen IV / COL4A1 Protein

Beta LifeScience SKU/CAT #: BLA-11696P

Native Human Collagen IV / COL4A1 Protein

Beta LifeScience SKU/CAT #: BLA-11696P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P02462
Synonym Arresten BSVD CO4A1_HUMAN COL4A1 COL4A1 NC1 domain COL4A2 COL4A3 COL4A4 COL4A5 collagen alpha-1(IV) chain Collagen IV Alpha 1 Polypeptide Collagen IV Alpha 2 Polypeptide Collagen Of Basement Membrane Alpha 1 Chain Collagen Of Basement Membrane Alpha 2 Chain Collagen Type IV Alpha 1 collagen type IV alpha 1 chain Collagen Type IV Alpha 2 Collagen Type IV Alpha 3 Collagen Type IV Alpha 4 Collagen Type IV Alpha 5 RATOR
Description Native Human Collagen IV / COL4A1 Protein is native.. It is a Full length protein
Source Native
AA Sequence ERGFPGIPGTPGPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMG LSFQGPKGDKGDQGVSGPPGVPGQAQVQEKGDFATKGEKGQKGEPGFQ GMPGVGEKGEPGKPGPRGKPGKDGDKGEKGSPGFPGEPGYPGLIGRQG PQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPGTPGPRGEPGPKGFPG LPGQPGPPGLPVPGQAGAPGFPGERGEKGDRGFPGTSLPGPSGRDGLPGP PGSPGPPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQK GESCLICDIDGYRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGVAGV PGPQGTPGLIGQPGAKGEPGEFYFDLRLKGDKGDPGFPGQPGMPGRAG SPGRDGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDTGPPGPPG YGPAGPIGDKGQAGFPGGPGSPGLPGPKGEPGKIVPLPGPPGAEGLPGSP GFPGPQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPGPKGVDGLPG DMGPPGTPGRPGFNGLPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGT PGEKGSIGVPGVPGEHGAIGPPGLQGIRGEPGPPGLPGSVGSPGVPGI GPPGARGPPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPGPKGDKGAQG LPGITGQSGLPGLPGQQGAPGIPGFPGSKGEMGVMGTPGQPGSPGPVGAP GLPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMK GQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDP GISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDK GAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPG MPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGT PGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKGDKGSKG EVGFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGD RGPQGQPGLPGLPGPMGPPGLPGIDGVKGDKGNPGWPGAPGVPGPKGD PGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKGLPGLQGIKGDQGD QGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQGLPGPKG QQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGPTGPRGFPGPPGPDGLP GSMGPPGTPSVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGN ERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPE PMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWS SLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCN YYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
Molecular Weight 161 kDa
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at +4°C. Store undiluted. Preservative: 0.01% Sodium azide

Target Details

Target Function Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.; Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation.
Subcellular Location Secreted, extracellular space, extracellular matrix, basement membrane.
Protein Families Type IV collagen family
Database References

HGNC: 2202

OMIM: 120130

KEGG: hsa:1282

STRING: 9606.ENSP00000364979

UniGene: PMID: 29604273

  • It seems that CD14 gene polymorphism might be associated with the risk of CAD, whereas COL4A1 gene polymorphism was not found to confer any risk of CAD PMID: 29299748
  • these data indicated that COL4A1 may confer trastuzumab resistance in gastric cancer. PMID: 29512712
  • VIPAR, with its partner proteins, regulate sorting of lysyl hydroxylase 3 (LH3, also known as PLOD3) into newly identified post-Golgi collagen IV carriers PMID: 27435297
  • Our study showed that the rs544012 AC and rs679505 AA genotypes were independently associated with the risk of ICH in the Chinese Han population and that the AA haplotype (rs3742207-rs11069830) in the COL4A1 gene may be related to the risk of ICH in the Chinese Han population PMID: 29360590
  • The rs532625 AA genotype in the COL4A1 gene was independently associated with the risk of disability and death in a Chinese Han population following intracerebral hemorrhage. PMID: 29477007
  • this study shows that COL4A1 production by urothelial carcinoma of the bladder plays a pivotal role in tumor invasion through the induction of tumor budding PMID: 28415608
  • Genotype-phenotype correlations in pathology caused by COL4A1 and COL4A2 mutations have been summarized. (Review) PMID: 27794444
  • Urine levels of COL4A1, COL13A1, the combined values of COL4A1 and COL13A1 (COL4A1 + COL13A1), and CYFRA21-1 were significantly elevated in urine from patients with BCa compared to the controls. A high urinary COL4A1 + COL13A1 was found to be an independent risk factor for intravesical recurrence. PMID: 28837258
  • Building collagen IV smart scaffolds on the outside of cells has been summarized. (Review) PMID: 28845540
  • Our findings extend the spectrum of COL4A1 mutations linked with renal disease and demonstrate that the highly conserved C-terminal part of the NC1 domain of the alpha1 chain of type IV collagen is important in the integrity of glomerular basement membrane in humans. PMID: 27190376
  • Twist1 appears to require both palladin and collagen alpha1(VI) as downstream effectors for its prometastatic effects, which could be future therapeutic targets in cancer metastasis. PMID: 26973246
  • only collagen-IV elicits the formation of proteolytically active podosomes through a mechanism involving increased Src phosphorylation, p190RhoGAP-B (also known as ARHGAP5) relocalisation and MT1-MMP (also known as MMP14) cell surface exposure at podosome sites. PMID: 27231093
  • Mutations upregulating COL4A1 expression lead topontine autosomal dominant microangiopathy with leukoencephalopathy (PADMAL). PMID: 27666438
  • The study shows an association of the COL4A1 gene with cerebral palsy and suggests a potential role of COL4A1 in the pathogenesis of this disease. PMID: 26748532
  • Differential protein expression of collagen IV, laminin alpha2, and nidogen-1 indicated basal lamina remodeling develops in ischemic failing versus nonfailing human hearts. PMID: 26756417
  • COL4A1 expression is significantly upregulated in human masticatory mucosa during wound healing. PMID: 28005267
  • pulmonary complications should be considered in patients with COL4A1 mutation-related disorders. PMID: 28017902
  • Chromosomal analysis and array-CGH showed no aberration. Target capture sequencing for COL4A1 and COL4A2 revealed a de novo COL4A1 mutation (c.2123G>T [p.Gly708Val]). PMID: 26879631
  • In porencephaly subjects with COL4A1 mutation, we did not detect significant alterations of immunofluorescence patterns in basal membranes of different skin structures. Heterozygous COL4A1 G749S mutation is associated with a normal immunofluorescence pattern of skin basement membranes. PMID: 26686511
  • High serum Collagen Type IV is associated with ovarian and breast cancer. PMID: 26406420
  • Hydroxylation and O-linked glycosylation sites in col4a1 from human lens capsule. PMID: 26593852
  • plasma levels increased in second and third trimester pre-eclampsia PMID: 26343951
  • SMAD3 is a necessary factor for TGFbeta-mediated stimulation of mRNA and protein expression of type IV collagen genes in human vascular smooth muscle cells; it regulates expression of COL4a1 and COL4a2 PMID: 26310581
  • COLIV is a promising tumour marker for CLM and can possibly be used to detect postoperative CLM recurrence. The combination of COLIV and CEA is superior to either marker alone in detecting CLM PMID: 26162539
  • analysis of the unique AAB composition and chain register for a heterotrimeric type IV collagen model peptide COL4a1/COL4a2 containing a natural interruption site PMID: 26209635
  • The catalytic domain of peroxidasin and its immunoglobulin (Ig) domains are required for efficient sulfilimine bond formation. PMID: 26178375
  • Studied the role of alpha1 and alpha2 chains of type IV collagen in UIP; found type IV collagen deposition in early fibrotic lesions of UIP may be implicated in refractory pathophysiology including migration of lesion fibroblasts via a FAK pathway. PMID: 26006016
  • The expression of collagen type IV and its alpha chains (alpha1-6) was investigated in different endothelial cell culture systems in vitro qualitatively and quantitatively. PMID: 23551189
  • Silencing the Col4-alpha1 gene or disrupting integrin engagement by blocking the antibody reduced the expression of platelet-derived growth factor A (PDGF-A), a potent chemotactic factor for fibroblasts. PMID: 25686533
  • A girl with porencephaly and an episode of microangiopathic hemolysis in infancy and her father with HANAC, both of whom had a heterozygous missense mutation of COL4A1, are reported. PMID: 25425218
  • This study expands the spectrum of COL4A1 phenotypes and indicates screening in patients with anophthalmia/microphthalmia regardless of MRI findings or presumed inheritance pattern. PMID: 24628545
  • Type IV collagen is an activating ligand for the adhesion G protein-coupled receptor GPR126. PMID: 25118328
  • The molecular basis of familial retinal arteriolar tortuosity was identified for the first time, thus expanding the human phenotypes linked to COL4A1 mutations. PMID: 25228067
  • Examined association between COL4A1 SNPs and intracranial aneurysms in Japanese cohort. PMID: 19506372
  • p53 directly activated transcription of the COL4A1 gene by binding to an enhancer region 26 kb downstream of its 3' end and increased the release of Arresten in the extracellular matrix. PMID: 22253229
  • Haploinsufficiency for COL4A1, rather than a dominant-negative effect of mutations, may cause intracerebral hemorrhage and white matter disease. PMID: 23065703
  • The novel mutation (c.2345 G > C) of the COL4A1 gene is the first report of a non-syndromic, autosomal dominant congenital cataract, thereby highlighting the important role of type IV collagen in the physiological and optical properties of the lens. PMID: 25124159
  • The whole exome sequencing showed no pathological mutations of COL4A1 and COL4A2 in fetal intraventricular hemorrhage PMID: 24317722
  • carbohydrate moiety (alpha-Gal) on laminin gamma-1 and collagen alpha-1 (VI) chain are possibly common IgE-reactive proteins in the Japanese patients with beef allergy PMID: 24180678
  • the integrin signaling pathway activated in a tumor environment with collagen deposition is responsible for low cell elasticity and high metastatic ability. PMID: 24823860
  • Both rs605143 and rs565470 of COL4A1gene are associated with coronary artery disease in the Uygur population of China. PMID: 24156251
  • Data indicate that the aberrantly methylated and expressed genes in cancer process including IRS1 and collagen-related genes COL4A1, COL4A2 and COL6A3. PMID: 23818951
  • In families where anterior segment dysgenesis occurs together with cerebral hemorrhages, genetic analysis of COL4A1 should be considered. PMID: 23394911
  • These data suggest novel roles for arresten in the regulation of oral squamous carcinoma cell proliferation, survival, motility and invasion through the modulation of cell differentiation state and integrin signaling. PMID: 23227231
  • Studies indicate that progenitor endothelial cells (ECs), endothelial colony-forming cells (ECFCs), deposit collagen IV, fibronectin, and laminin. PMID: 22919069
  • COL4A1 mutations have been identified in adult patients with cerebral small vessel diseases. PMID: 22868088
  • COL4A1 mutations are associated with schizencephaly and hemolytic anemia; genetic testing for COL4A1 should be considered for children with these conditions. PMID: 23225343
  • This study demonistrated that patients with COL4A1 mutations raised creatine kinase and cerebral calcification. PMID: 22932948
  • The data suggested that miR-21 is involved in the regulation of the synthesis of COL4A1, a component of the basement membrane surrounding the GC layer and granulosa-embedded extracellular structure. PMID: 22573493
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed