Native Human Alpha 1 Acid Glycoprotein/AGP
Beta LifeScience
SKU/CAT #: BLA-11638P
Native Human Alpha 1 Acid Glycoprotein/AGP
Beta LifeScience
SKU/CAT #: BLA-11638P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | P02763 |
| Synonym | A1AG1_HUMAN AGP AGP 1 AGP A AGP1 Alpha 1 acid glycoprotein Alpha-1-acid glycoprotein 1 alpha-1-AGP Epididymis secretory sperm binding protein Li 153w glycoprotein, alpha-1-acid, of serum HEL S 153w OMD 1 ORM ORM1 Orosomucoid 1 Orosomucoid-1 |
| Description | Native Human Alpha 1 Acid Glycoprotein/AGP is native.. It is a Full length protein |
| Source | Native |
| AA Sequence | QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFY FTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAH LLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRI PKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES |
| Molecular Weight | 45 kDa |
| Purity | >95% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Bioactivity | Native Human Alpha 1 Acid Glycoprotein/AGP is shown to be non reactive for HBsAg, anti-HCV, anti-HBc,and negative for anti-HIV 1 2. |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
