Biotinylated Recombinant Salmonella Typhimurium Protein Prgi (PRGI) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-00916P
Greater than 90% as determined by SDS-PAGE.
Biotinylated Recombinant Salmonella Typhimurium Protein Prgi (PRGI) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-00916P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Salmonella Typhimurium Protein Prgi (PRGI) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P41784 |
Target Symbol | PRGI |
Species | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
Expression Range | 1-80aa |
Protein Length | Full Length |
Mol. Weight | 56.6 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Required for invasion of epithelial cells. |
Protein Families | MxiH/PrgI/YscF family |
Database References | KEGG: stm:STM2873 STRING: 99287.STM2873 |
Gene Functions References
- analysis of structural and functional similarity between the bacterial type III secretion system needle protein PrgI and the eukaryotic apoptosis Bcl-2 proteins PMID: 19823588
- Thermodynamic characterization of the structural stability of the PrgI protein. PMID: 16501225
- analysis of electrostatic surfaces of the type III secretion needle proteins PrgI, BsaL, and MxiH PMID: 17617421