Biotinylated Recombinant Mouse Interleukin-11 (IL11) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-01563P
Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Mouse Interleukin-11 (IL11) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-01563P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Mouse Interleukin-11 (IL11) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P47873 |
Target Symbol | IL11 |
Synonyms | IL-11 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Expression Range | 22-199aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 66.9 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation, also in the context of various cancers. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'. |
Subcellular Location | Secreted. |
Protein Families | IL-6 superfamily |
Database References |
Gene Functions References
- Consistent with these in vitro findings, IL-11 promoted HSC engraftment in a mouse model of AA, an effect that was attenuated in cells overexpressing miR-204-5p. The reduction in miR-204-5p levels is an integral component of IL-11 signaling that may play an essential role in treating aplastic anemia (AA). PMID: 29217821
- classic but not trans-signaling essential for fertility PMID: 28864002
- activates PDIA4 in placenta PMID: 28487027
- these findings suggest that classic signalling rather than trans-signalling is the mode by which IL-11 promotes gastric tumourigenesis. PMID: 28160627
- Results indicate that iterleukin-11 (IL11) is causal of Preeclampsia (PE) features in a mouse model and likely in women, and suggest potential of IL11 inhibition to rescue PE symptoms in women. PMID: 26655736
- IL-11-mediated STAT3 signaling not only reduces hepatocellular apoptosis, but also inhibits inflammatory responses. PMID: 25946003
- IL-1 signaling antagonizes IL-11/STAT3 mediated pathology and the genetic deletion of IL-1RT1 results in increased tumor burden. PMID: 25528766
- PGF2alpha inhibits adipocyte differentiation by means of an IL-11 mediated autocrine negative feedback loop, that acts via gp130 to block adipogenesis through the essential actions of the STAT1 transcription factor. PMID: 24519625
- Data indicate that colonic inflammation was more severe in mice fed an iron-supplemented compared with a control diet one week post-DSS treatment, with enhanced colonic IL-6 and IL-11 release and Stat3 phosphorylation. PMID: 24223168
- IL-11 reduced the production of reactive oxygen species. PMID: 23852503
- IL-11 therefore drives a pathway that enhances HSPC radioresistance and radiation-induced B-cell malignancies, but is normally attenuated by the inhibitory adaptor Lnk. PMID: 24297922
- IL-11 signaling may not play as significant a role in spinal cord injury as other glycoprotein gp130 cytokines. PMID: 22715999
- Data support the view that IL-11 is a key regulator of gastric damage acting to initiate chronic atrophic gastritis. PMID: 22180059
- Bovine lactoferrin administration prevented the progression of hepatic failure in human myofibroblasts and mice, and enhanced IL-11 and BMP2 expression in the small intestine. PMID: 21688123
- the mutant gp130 receptor protein from inflammatory hepatocellular adenoma is inhibited by an anti-gp130 antibody that specifically neutralizes interleukin 11 signaling PMID: 22523320
- IL-11 provides a functional link between oxidative stress and compensatory proliferation PMID: 22253262
- These findings imply a pathogenic role for IL-11 during the early phase of Mycobacterium tuberculosis-triggered disease in a genetically susceptible host. PMID: 21789190
- Mechanical stress activates Smad pathway through PKCdelta to enhance interleukin-11 gene transcription in osteoblasts. PMID: 20927330
- Addition of exogenous IL-11 protected against the lethal colitis in TLR2-deficient mice via STAT3 activation in intestinal epithelial cells. PMID: 20600022
- IL-11 attenuated cardiac fibrosis after MI through STAT3. Activation of the IL-11/glycoprotein 130/STAT3 axis may be a novel therapeutic strategy against cardiovascular diseases. PMID: 20100971
- These observations are consistent with the notion that mechanical stress stimulates IL-11 gene transcription via an enhanced DeltaFosB/JunD binding to the IL-11 gene promoter. PMID: 19665600
- IL-11 stimulates osteoclastic resorption in mouse calvariae that is independent of cell growth; partially dependent on prostaglandin biosynthesis; sensitive to inhibition by IL-4, IL-13 and OPG; and associated with enhanced expression of RANKL and OPG. PMID: 12110441
- Tumor-derived IL-11 may play a role in the depressed IL-12 production by macrophages, leading to the impaired immune functions observed during mammary tumorigenesis. PMID: 12527946
- The induction of hsp25 by IL-11 confers epithelial-specific cytoprotection that is independent of phosphorylation-dependent co-localization of hsp25 to F-actin, contributing to the protective effects of IL-11 in models of intestinal epithelial injury. PMID: 12730876
- interleukin-11 regulates adipocyte metabolism and gene expression PMID: 12791389
- Overexpression of interleukin 11 is associated with breast cancer metastasis to bone PMID: 12842083
- two tandem activating protein-1 (AP-1) sites that reside immediately upstream of TATA box play critical roles in IL-11 gene transcription PMID: 12929935
- IL-11 signaling is required for decidual-specific maturation of natural killer cells. PMID: 15499555
- heparin enhances IL-11-induced STAT3 activation and thus osteoclast formation, by a mechanism that is independent of STAT3 Ser-727 phosphorylation but that involves up-regulation of the MAPK pathway PMID: 16720575
- IL-11 signals through the Jak2/Stat3 pathway in decidual cells to stimulate the expression of alpha(2)-MG, a protease inhibitor essential for normal placentation in pregnancy. PMID: 16959875
- genetically define distinct roles of IL-6 and IL-11 in driving pathologic hematopoietic and lymphoid responses mediated by STAT3 hyperactivation PMID: 17082315
- Gnai2 knockout mice show significantly reduced intestinal IL-11 production. Suggest MAP kinases, PGE2 and cAMP mediated signaling involved. PMID: 17332478
- These results provide, at least in part, an explanation for the defective small decidua of mice lacking the Il11ra gene, and reveal for the first time that cyclin D3, CDKN1A (p21), and BIRC5 (Survivin) are targets of IL11 in the decidua. PMID: 17881769
- An increase in caspase-3 was seen in hyperoxia-exposed lungs of wild-type pups compared to IL-11 (+) pups PMID: 18214944
- Data identify IL-11 as a crucial cytokine promoting chronic gastric inflammation and associated tumorigenesis in gp130 receptor-eficient mice mediated by excessive activation of STAT3 and STAT1. PMID: 18431520
- Th2 and IL-13 responses can be regulated by interventions that manipulate IL-11 signaling in the murine lung. PMID: 18617680
- Increased gastric IL-11 alters expression of proliferative and cytoprotective genes and promotes pretumorigenic cellular changes PMID: 19121317
- IL-11 regulates inflammatory demyelination via a unique combination of immunoregulation and neuroprotection. PMID: 19734214