Biotinylated Recombinant Mouse Estrogen Receptor (ESR1) Protein (MBP&His-Avi)

Name: Biotinylated Recombinant Mouse Estrogen Receptor (ESR1) Protein (MBP&His-Avi)
Brand: Beta LifeScience
SKU: BLC-07228P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Avi-tagged proteins, Biotinylated proteins, Featured biotinylated protein molecules, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Biotinylated Recombinant Mouse Estrogen Receptor (ESR1) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P19785
Target Symbol	ESR1
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-MBP&C-6His-Avi
Target Protein Sequence	MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI
Expression Range	1-599aa
Protein Length	Full Length
Mol. Weight	114.7 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3.
Subcellular Location	Nucleus. Cytoplasm. Golgi apparatus. Cell membrane.
Protein Families	Nuclear hormone receptor family, NR3 subfamily
Database References	KEGG: mmu:13982 STRING: 10090.ENSMUSP00000070070 UniGene: PMID: 29549264 ERalpha-signaling may be crucial for vibration-induced effects on fracture healing, whereas ERbeta-signaling may play a minor role PMID: 29367057 hepatic Estradiol/ESR1 signaling plays a key role in the maintenance of gluconeogenesis and lipid metabolism in males. PMID: 28490809 ESR1 inhibits chorionic gonadotropin-induced steroidogenesis and proliferation of progenitor Leydig cells in mice. PMID: 28266530 suppresses breast cancer metastasis by regulating vinculin PMID: 28266545 High ESR1 expression is associated with metastasis in breast Cancer. PMID: 29187405 Study demonstrates an unexpected phenotype in high fat diet-fed estrogen receptor alpha (ERalpha) knockout mice involving severe uterine bacterial infections likely resulting from a previously unknown negative interference between dietary fatty acids and ERalpha-signaling during anti-microbial defence. PMID: 28233809 study found that 27-HC promoted the growth of melanoma cells by activating ERalpha and eliciting the AKT and MAPK signaling pathway. PMID: 29130512 By using mutant mice with liver-specific ablation of Eralpha, the authors here demonstrate that the hepatic ERalpha is essential for the modulation of the activity of Agouti Related Protein (AgRP) neurons in relation to the reproductive cycle and diet. PMID: 28446774 DNA methylation and transcriptome aberrations mediated by ERalpha in mouse seminal vesicles following developmental DES exposure. PMID: 29666266 This novel transgenic mouse line will be a useful animal model for lineage-tracing Esr1-expressing cells, selective gene ablation in the Esr1-lineage cells and for generating global Esr1 knockout mice. PMID: 29115049 Data (including data from studies in transgenic mice) suggest that Esr1 signaling promotes activation of Pp2a; here, central activation of Pp2a during estrogen replacement therapy is involved in prevention of menopause-induced obesity and glucose intolerance (that is, induced by lack of membrane-initiated Esr1 signaling). (Esr1 = estrogen receptor 1; Pp2a = protein phosphatase 2A) PMID: 29764860 Results show that membrane initiated ERalpha signaling is important for the estrogen response in adult female mice in vivo in a tissue-dependent manner, and that membrane ERalpha signaling is crucial for the estrogen response in trabecular bone in the axial skeleton. PMID: 27388455 Results show that ERalpha activation might constitute one of the neural substrate that is involved involved in the facilitative mechanisms to restore the sexual olfactory preferences of sexually naive Tph2-/- female mice. PMID: 29470551 Study found that estrogen receptor alpha (ERalpha) was expressed in the motoneurons of lumbar ventral horn. ERalpha and ERbeta were mainly localized in the nuclei of motoneurons with less immunoreactivity in the cytoplasm. PMID: 28501695 suggest miR-181a inhibition enhances E2-mediated stroke protection in females in part by augmenting ERalpha production PMID: 28522364 nuclear Shp2, rather than cytosolic Shp2, promotes the ERalpha transcription activity. This function is achieved by enhancing the Src kinase-mediated ERalpha tyrosine phosphorylation, which facilitates ERalpha binding to Pgr promoter in an ERK-independent manner in periimplantation uteri. PMID: 28424251 ERalpha masculinizes GABAergic neurons that gate the display of male-typical behaviors. PMID: 28734725 The administration of ICI182,780, which is an agonist of G-protein coupled estrogen receptor (GPER) and an antagonist of ERa and ERb, did not result in protection; however, ICI182,780 significantly blocked EDC-mediated cardioprotection, indicating participation of ERalpha and/or ERbeta PMID: 28457941 Data (including data from studies using knockout mice) suggest that early initiation of endometriosis is predominantly dependent on immune system; cross-talk occurs between Esr1 and Il6 pathways during early initiation of endometriosis lesion development; estradiol stimulation of Esr1 appears to play minor role in early lesion development. (Esr1 = estrogen receptor alpha; Il6 = interleukin 6) PMID: 28927243 Studies indicate that lack of estrogen receptor alpha (ERalpha) in osteoblast progenitor and precursor cells generally affects the periosteum of female and male mice. PMID: 29148577 extra-nuclear estrogen signaling affects cortical bone mass in males, and this effect is dependent on a functional ERalphaAF-1. PMID: 28057769 Transgenic mouse line expressing the human Ki-Ras bearing an activating mutation (Ki-Ras((G12V))) selectively in the mammary epithelium develop estrogen receptor alpha (ERalpha)-positive ductal adenocarcinomas with 100% incidence within 3-9 months after Ki-Ras((G12V)) induction. PMID: 28745321 mouse mammary ER(+) and ER(-) luminal cells are two independent lineages that are maintained by distinct stem cells, providing a revised mammary epithelial cell hierarchy. PMID: 28329676 Lupus-prone ERalpha -/- mice are not protected from lupus disease expression if ovariectomized. PMID: 28822833 Taken together, the above results clearly demonstrated an mTORC2-dependent regulation of actin polymerization that contributed to the effects of ERalpha and ERbeta on spatial learning, which may provide a novel target for the prevention and treatment of E2-related dementia in the aged population PMID: 28789972 These findings suggest that RASD1 acts as a novel signaling molecule and plays an important role in regulating dynamic uterine remodeling during the estrous cycle in the uterus. PMID: 28188843 Truncating mutations of Prlr promote tumor growth in a model of human ERalpha+ breast cancer. PMID: 27681435 This comparative study documented the complexity of ERalpha genes, mRNAs, and proteins, and further determined the underlying structural basis of ligand-independent activation by C-terminally-truncated ERalpha variants. PMID: 28412386 E2-ERs system was functional in maintaining oocyte meiotic arrest by regulating the expression of natriuretic peptide C and natriuretic peptide receptor 2 (NPPC/NPR2) PMID: 28277543 Ventromedial hypothalamus neurons expressing Esr1 are indispensable for female aggression. PMID: 28920934 Increased DNA methylation accompanied this pattern, particularly at CpG dinucleotides located within binding or flanking regions for the transcriptional regulator CCCTC-binding factor of ESR1 and ESR2, consistent with sustained transcriptional activation of ERa and ERb PMID: 28373182 Ciliary length and beat frequency of the oviductal epithelial cells are regulated through ESR1. PMID: 28082352 Loss of endothelial ERalpha reduces vascular stiffness in male mice fed a Western Diet with an associated outward hypertrophic remodeling of resistance arteries. PMID: 28430983 results also suggest that, in the presence of adult endogenous steroid levels, ERalpha36 overexpression in vivo contributes to alter mammary gland architecture which may support pre-neoplastic lesion and augment breast cancer risk PMID: 28301550 Activation of HIF1A by prolonged in vivo hyperinsulinemia potentiates cancerous progression in estrogen receptor-positive breast cancer cells. PMID: 28351619 Gene-environment interactions driven by early life xenoestrogen exposure likely contributes to increased risk of estrogen-related disease in adults. PMID: 27312807 activation in the medial amygdala during the pubertal period is crucial for male mice to fully express their male-type social behaviors in adulthood PMID: 27325769 Data suggest that prenatal exposure to p,p'-DDT (an endocrine disrupting pesticide) causes sex- and age-independent attenuation of Esr1 in brain which may be involved in propagation of DDT-induced depressive-like neurotoxicity. PMID: 28263910 Here, the authors demonstrate that mature miRNA-22 is more abundant in muscle from male mice relative to females and that this enables sex-specific regulation of muscular lipid metabolism and body weight by repressing estrogen receptor alpha (ERalpha) expression. PMID: 28314781 Estrogen response element-independent regulation in the arcuate nucleus is mainly mediated by tethering of ERalpha. PMID: 28359086 ERalpha acts in a B cell-intrinsic manner to control B cell activation, autoantibody production, and lupus nephritis PMID: 27989899 These findings identify a previously unknown role for membrane ESR1 in the development of normal sperm and providing an adequate environment for spermatogenesis. PMID: 27145009 The present results showed that ER knockout alpha and beta male mice had lower striatal mGlu5 receptor binding and protein measured by Western blot. PMID: 26873133 However, the SERMs had slightly different effects on the appendicular skeleton since only Las increased the trabecular bone mass and only Ral increased the cortical porosity. Importantly, all SERM effects require a functional ERalphaAF-1 in female mice. These results could lead to development of more specific treatments for osteoporosis. PMID: 27048997 Kiss1 in the medial amygdala is regulated primarily by estrogen receptor alpha, and not estrogen receptor beta. PMID: 27564649 The balance between inhibitory effects of central ERalpha activity in hypothalamic POMC neurons in arcuate nucleus of the hypothalamus and stimulatory peripheral ERalpha-mediated effects in bone determines cortical bone mass in female mice. PMID: 27254004 we found that post-ejaculated semen from fertile wild-type males was solidified and the sperm were entrapped in Wnt7aCre/+;Esr1f/f uteri, compared to the watery semen (liquefied) found in Esr1f/f controls.Kallikrein-related peptidases 3 (KLK3) and other kallikrein-related peptidases from male prostate glands are responsible for semen liquefaction by cleaving gel-forming proteins PMID: 28414719 we showed that, in the absence of ERalpha, G93A-SOD1 failed to activate OMI and the proteasome, confirming the ERalpha dependence of the response. Taken together, these results demonstrate the IMS-UPRmt activation in SOD1 familial Amyotrophic lateral sclerosis , and suggest that sex differences in the disease phenotype could be linked to differential activation of the ERa axis of the IMS-UPRmt PMID: 28186560 Here we describe the generation of a gene-targeted mouse line that enables CRE-inducible expression of a conditionally-active fusion between the ROCK2 kinase domain and the hormone-binding domain of a mutated estrogen receptor (ROCK2:ER). This two-stage system of regulation allows for tissue-selective expression of the ROCK2:ER fusion protein, which then requires administration of estrogen analogues PMID: 27775859

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.