Biotinylated Recombinant Human Ul16-Binding Protein 1 (ULBP1) Protein (mFc-Avi), Active
Beta LifeScience
SKU/CAT #: BLC-05826P
Biotinylated Recombinant Human Ul16-Binding Protein 1 (ULBP1) Protein (mFc-Avi), Active
Beta LifeScience
SKU/CAT #: BLC-05826P
Regular price
$54000
$540.00
Sale price$24000
$240.00Save $300
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Biotinylated Recombinant Human Ul16-Binding Protein 1 (ULBP1) Protein (mFc-Avi), Active is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human Biotinylated ULBP1, the EC 50 is 4.254-7.295 ng/ml. |
Uniprotkb | Q9BZM6 |
Target Symbol | ULBP1 |
Synonyms | (ALCAN-beta)(NKG2D ligand 1)(N2DL-1)(NKG2DL1)(Retinoic acid early transcript 1I)(N2DL1)(RAET1I) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-mFc-Avi |
Target Protein Sequence | GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG |
Expression Range | 26-216aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 51.3 kDa |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum. |
Protein Families | MHC class I family |
Database References | |
Tissue Specificity | Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver. |
Gene Functions References
- we show that Simian Virus 40 (SV40)...evades NK cell attack through the down regulation of...ULBP1 PMID: 26992229
- ATF4 drives ULBP1 gene expression in cancer cell lines, while the RNA-binding protein RBM4 supports ULBP1 expression by suppressing a novel alternatively spliced isoform of ULBP1 mRNA. PMID: 26565589
- expression determines intrinsic acute myeloid leukemia susceptibility to allogeneic V[gamma]9V[delta]2 T cells PMID: 24911793
- recurrence-free survival of patients with ULBP1-negative hepatocellular carcinoma (HCC) was significantly shorter than that of patients with ULBP1-positive HCC PMID: 21756848
- recombinant ULBP1 fused to CD45 caused a reduction in cytotoxicity and degranulation by NK cells, implying a role for receptor ligand distribution in the activation of NK cell responses PMID: 21464092
- Data show that ULBP1, TFR2 and IFITM1 were associated with increased susceptibility to Vgamma9Vdelta2 T-cell cytotoxicity. PMID: 20220060
- These results identify Mult1 as a target for the MARCH family of E3 ligases PMID: 20870941
- As NKG2D ligand, ULBP1 are expressed on immature dendritic cells and plays an important role in the cytotoxic effect of NK cells against iDC. PMID: 18394338
- Data show that the protease NS3/4A of HCV down-regulates ULBP1 expression by inhibiting the transcription of ULBP1. PMID: 19500498
- ULBP1 binds to the NKG2D receptor and activates multiple signaling pathways in primary natural killer cells. PMID: 11777960
- The NKG2D ligand ULBP1 is up-regulated and readily detectable intracellularly in the endoplasmic reticulum of human cytomegalovirus-infected fibroblasts, where it colocalizes with viral protein UL16. PMID: 12847260
- ULBP1 is a human ligand of the NKG2D receptor PMID: 16901903
- The selective induction of ULBP1 expression by proteasome inhibitor drugs, along with variable NKG2D ligand expression by human tumor cells, indicates that NKG2D ligand genes are independently regulated. PMID: 19414815