Biotinylated Recombinant Human Ul16-Binding Protein 1 (ULBP1) Protein (mFc-Avi), Active

Name: Biotinylated Recombinant Human Ul16-Binding Protein 1 (ULBP1) Protein (mFc-Avi), Active
Brand: Beta LifeScience
SKU: BLC-05826P
Price: 648.8 USD
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human Biotinylated ULBP1, the EC 50 is 4.254-7.295 ng/ml. Biological Activity Assay

Collections: Avi-tagged proteins, Biotinylated proteins, Featured biotinylated protein molecules, Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Biotinylated Recombinant Human Ul16-Binding Protein 1 (ULBP1) Protein (mFc-Avi), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human Biotinylated ULBP1, the EC 50 is 4.254-7.295 ng/ml.
Uniprotkb	Q9BZM6
Target Symbol	ULBP1
Synonyms	(ALCAN-beta)(NKG2D ligand 1)(N2DL-1)(NKG2DL1)(Retinoic acid early transcript 1I)(N2DL1)(RAET1I)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-mFc-Avi
Target Protein Sequence	GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
Expression Range	26-216aa
Protein Length	Full Length of Mature Protein
Mol. Weight	51.3 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum.
Protein Families	MHC class I family
Database References	HGNC: 14893 OMIM: 605697 KEGG: hsa:80329 STRING: 9606.ENSP00000229708 UniGene: Hs.653255
Tissue Specificity	Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.

Gene Functions References

we show that Simian Virus 40 (SV40)...evades NK cell attack through the down regulation of...ULBP1 PMID: 26992229
ATF4 drives ULBP1 gene expression in cancer cell lines, while the RNA-binding protein RBM4 supports ULBP1 expression by suppressing a novel alternatively spliced isoform of ULBP1 mRNA. PMID: 26565589
expression determines intrinsic acute myeloid leukemia susceptibility to allogeneic V[gamma]9V[delta]2 T cells PMID: 24911793
recurrence-free survival of patients with ULBP1-negative hepatocellular carcinoma (HCC) was significantly shorter than that of patients with ULBP1-positive HCC PMID: 21756848
recombinant ULBP1 fused to CD45 caused a reduction in cytotoxicity and degranulation by NK cells, implying a role for receptor ligand distribution in the activation of NK cell responses PMID: 21464092
Data show that ULBP1, TFR2 and IFITM1 were associated with increased susceptibility to Vgamma9Vdelta2 T-cell cytotoxicity. PMID: 20220060
These results identify Mult1 as a target for the MARCH family of E3 ligases PMID: 20870941
As NKG2D ligand, ULBP1 are expressed on immature dendritic cells and plays an important role in the cytotoxic effect of NK cells against iDC. PMID: 18394338
Data show that the protease NS3/4A of HCV down-regulates ULBP1 expression by inhibiting the transcription of ULBP1. PMID: 19500498
ULBP1 binds to the NKG2D receptor and activates multiple signaling pathways in primary natural killer cells. PMID: 11777960
The NKG2D ligand ULBP1 is up-regulated and readily detectable intracellularly in the endoplasmic reticulum of human cytomegalovirus-infected fibroblasts, where it colocalizes with viral protein UL16. PMID: 12847260
ULBP1 is a human ligand of the NKG2D receptor PMID: 16901903
The selective induction of ULBP1 expression by proteasome inhibitor drugs, along with variable NKG2D ligand expression by human tumor cells, indicates that NKG2D ligand genes are independently regulated. PMID: 19414815

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.