Biotinylated Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (mFc-Avi)
Biotinylated Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (mFc-Avi)
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Avi-tagged proteins, Biotinylated proteins, Buy cytokines, chemokines, and growth factors for research online, Celebrate thanksgiving with 30% off all beta lifescience products!, Featured biotinylated protein molecules, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, In-stock recombinant proteins, Recombinant cell therapy targets for car-t research, Tumor necrosis factors and receptors (tnfs)
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Biotinylated Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (mFc-Avi) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q02223 |
| Target Symbol | TNFRSF17 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-mFc-Avi |
| Target Protein Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Expression Range | 1-54aa |
| Protein Length | Partial |
| Mol. Weight | 34.9 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. |
| Subcellular Location | Cell membrane; Single-pass type III membrane protein. Endomembrane system; Single-pass type III membrane protein. Note=Perinuclear Golgi-like structures. |
| Database References | HGNC: 11913 OMIM: 109545 KEGG: hsa:608 STRING: 9606.ENSP00000053243 UniGene: PMID: 29087261 |

