Biotinylated Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14) Protein (hFc-Avi), Active

Name: Biotinylated Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14) Protein (hFc-Avi), Active
Brand: Beta LifeScience
SKU: BLC-05828P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 at 5 μg/ml can bind Biotinylated human TNFSF14, the EC 50 is 1.773-3.707 ng/ml. Biological Activity Assay

Collections: All products, Avi-tagged proteins, Biotinylated proteins, Buy cytokines, chemokines, and growth factors for research online, Co-stimulatory receptors, Featured biotinylated protein molecules, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, Recombinant proteins fall special offers - active proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Biotinylated Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14) Protein (hFc-Avi), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 at 5 μg/ml can bind Biotinylated human TNFSF14, the EC 50 is 1.773-3.707 ng/ml.
Uniprotkb	O43557
Target Symbol	TNFSF14
Synonyms	TNFSF14; HVEML; LIGHT; UNQ391/PRO726; Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	N-hFc-Avi
Target Protein Sequence	DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Expression Range	74-240aa
Protein Length	Partial
Mol. Weight	47.3 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production.
Subcellular Location	[Tumor necrosis factor ligand superfamily member 14, membrane form]: Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 14, soluble form]: Secreted.; [Isoform 2]: Cytoplasm.
Protein Families	Tumor necrosis factor family
Database References	HGNC: 11930 OMIM: 604520 KEGG: hsa:8740 STRING: 9606.ENSP00000469049 UniGene: PMID: 29359470 LIGHT is highly expressed and companied with severe inflammations in patients with coronary disease. LIGHT significantly enhanced inflammation response in oxLDL-induced THP-1 macrophages. PMID: 28642135 LIGHT and LTBR interaction increases the survival and proliferation of human bone marrow-derived mesenchymal stem cells, and therefore, LIGHT might play an important role in stem cell therapy. PMID: 27835685 Serum LIGHT levels correlate with disease progression and severity in interstitial pneumonia patients with dermatomyositis. PMID: 26448572 LIGHT, via LTbetaR signaling, may contribute to exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells. PMID: 25501580 LIGHT controls TSLP to drive pulmonary fibrosis. PMID: 25680454 The tumor necrosis factor superfamily molecule LIGHT promotes keratinocyte activity and skin fibrosis. PMID: 25789702 proliferation and migration would be enhanced in Tca8113 cells with over-expressed TNFSF14 PMID: 26146063 LIGHT, a TNF superfamily member, is involved in T-cell homeostasis and erosive bone disease associated with rheumatoid arthritis. PMID: 25460501 Crystal structures of LIGHT and the LIGHT:DcR3 complex reveal the structural basis for the DcR3-mediated neutralization of LIGHT. PMID: 25087510 regulation by NK cell licensing helps to safeguard against TNFSF14 production in response to healthy tissues. PMID: 25512551 The findings suggest a new molecular determinant of LIGHT-mediated pathogenic changes in human bronchial epithelial cells. PMID: 25251281 TNFSF14 has an effect on the activation of basophils and eosinophils interacting with bronchial epithelial cells PMID: 24782592 Triggering of LIGHT induced production of pro-inflammatory mediators such as interleukin-8 and matrix metalloproteinase-9 while suppressing the phagocytic activity. PMID: 24044961 GG carriers of rs1077667, of the LIGHT gene, with the highest risk for Multiple Sclerosis, had the lowest serum levels. PMID: 23037546 although a limited number of activated T-cells infiltrate the tumor and initiate an immune response, the number of LIGHT + T cells infiltrating the tumor is very low PMID: 23514280 findings show that LIGHT is not inhibited by the soluble RANKL receptor OPG and that LIGHT is a potent osteoclastogenesis factor that activates the Akt, NFkappaB and JNK pathways PMID: 23391709 TNFSF14 was significantly increased in sickle-cell anemia, SCA treated with hydroxycarbamide,& HbSC. It could contribute to endothelial activation & inflammation in SCA. PMID: 22775554 This study showed that expression of the death-triggering ligand LIGHT is increased in ALS spinal cords PMID: 22221541 increased plasma levels in patients with atopic dermatitis PMID: 22519595 INF-gamma can synergistically precede LIGHT-induced apoptotic processes through down-regulation of Bcl-2 expression, but not survivin expression. PMID: 21117871 These data clearly indicate that ZFP91 is a key regulator in LIGHT-induced activation of non-canonical NF-kappaB pathway in LTbetaR signaling. PMID: 20804734 Herpes simplex virus 1 gD interfere HVEM function by competing with its natural ligands and by downregulating HVEM. PMID: 20826693 Increased potential for LIGHT receptor signaling, coupled with increased bioavailability due to lower decoy receptor-3 (DcR3) avidity, provides a mechanism for polymorphic variants in LIGHT to contribute to the pathogenesis of inflammatory diseases. PMID: 20592286 mediates organ-specific donor T cells activation in GVHD PMID: 19826934 suppresses tumor growth by augmentation of immune response PMID: 19716382 There is over expression of genes related to immune and inflammatory responses, including cytokines such as TNFSF14 in interstitial cystitis PMID: 20096889 When highly expressed, LIGHT is capable of promoting effector T cell proliferation and differentiation even in a regulatory T (Treg) cell-enriched, suppressive intestinal environment. PMID: 20042587 These findings suggested that LIGHT might be involved in the progression of inflammatory bone destruction in rheumatoid arthritis. PMID: 19019090 Effects in transgenic mice indicate that human LIGHT may function as a major regulator of T cell activation, and implicate LIGHT signaling pathways in inflammation focused on mucosal tissues. PMID: 11714797 LIGHT (TNFSF14),5 its membrane-anchored ligand, was also present in atheromatous lesions and highest in regions rich in macrophage-derived foam cells. PMID: 11742858 Role of calcium-signaling pathway in the transcriptional control PMID: 12215452 LIGHT may act as an anti-apoptotic agent against TNFalpha-mediated liver injury by blocking the activation of both caspase-3 and caspase-8. PMID: 12393901 LIGHT, a new member of the TNF superfamily [review] PMID: 12456019 Data show that mRNA encoding LIGHT and its receptors [HVEM, LTbetaR, and TR6 (DcR3)] are present in placentas and cytotrophoblast cells at term. PMID: 12466117 Soluble LIGHT blocks TR6-Fc costimulated proliferation, lymphokine production, and cytotoxicity of T cells in the presence of T cell receptor ligation. PMID: 12471113 LIGHT-sensitized IFN-gamma-mediated apoptosis of MDA-MB-231 cells is probably through down-regulation of anti-apoptosis Bcl-2 family members; it could be caspase (especially caspase-3)-independent, even though extensive caspase activation was observed. PMID: 12767529 LIGHT signaling is mediated through both death receptor and mitochondria pathways PMID: 15115612 LIGHT-herpesvirus entry mediator mediated signaling as an important immune regulatory mechanism in mucosal inflammatory responses. PMID: 15210782 Mechanisms protecting trophoblast cells from LIGHT-mediated apoptosis were studied. PMID: 15215185 LIGHT expression by human intestinal T cells suggests the possibility that LIGHT may play a key role in regulation of the mucosal immune system. PMID: 15634882 LIGHT protein can be activated on mucosal T cells through a gut-specific CD2-dependent signaling mechanism. PMID: 15634882 Data suggest that LIGHT constitutively expressed in human melanoma cells and microvesicles may contribute to regulate T-cell responses to tumor cells. PMID: 15833878 NF-kappaB signal plays a key role in LIGHT-mediated upregulation of CD86 expression. PMID: 15895390 both LTbetaR and HVEM can discriminatively mediate the expression of different genes in cultured human umbilical vein endothelial cells, including LIGHT, a proinflammatory cytokine PMID: 15917993 A transgenic mouse model resembling Crohn's disease (CD) suggests that up-regulation of LIGHT may be an important mediator of CD pathogenesis. PMID: 15944326 LIGHT could serve as a molecular link between lipid metabolism, inflammation, and thrombus formation, which are all features of atherosclerotic plaques. PMID: 16186421 platelet-derived LIGHT is biologically active and can induce an inflammatory response in monocytes and particularly within endothelial cells measured as up-regulation of adhesion molecules and release of chemokines PMID: 16861346 Blockade of TNFSF14 signaling caused a substantial reduction in the expression of lymphotoxin beta receptor (LTbetaR)-controlled migration factors within the islets and disrupts organization of tertiary structures, leading to prevention of diabetes. PMID: 16934497 LIGHT system may regulate early to middle stages of placental development via cell-specific, temporally programmed expression of the ligand and its receptors, and may also assist in preserving placental immune privilege. PMID: 17010447

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Biotinylated Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14) Protein (hFc-Avi), Active

Biotinylated Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14) Protein (hFc-Avi), Active

Product Overview

Target Details

FAQs