Biotinylated Recombinant Human Shc-Transforming Protein 1 (SHC1) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06742P
Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Human Shc-Transforming Protein 1 (SHC1) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06742P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Human Shc-Transforming Protein 1 (SHC1) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P29353 |
Target Symbol | SHC1 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | HPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPP |
Expression Range | 150-320aa |
Protein Length | Partial |
Mol. Weight | 66.4 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Signaling adapter that couples activated growth factor receptors to signaling pathways. Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Isoform p46Shc and isoform p52Shc, once phosphorylated, couple activated receptor tyrosine kinases to Ras via the recruitment of the GRB2/SOS complex and are implicated in the cytoplasmic propagation of mitogenic signals. Isoform p46Shc and isoform p52Shc may thus function as initiators of the Ras signaling cascade in various non-neuronal systems. Isoform p66Shc does not mediate Ras activation, but is involved in signal transduction pathways that regulate the cellular response to oxidative stress and life span. Isoform p66Shc acts as a downstream target of the tumor suppressor p53 and is indispensable for the ability of stress-activated p53 to induce elevation of intracellular oxidants, cytochrome c release and apoptosis. The expression of isoform p66Shc has been correlated with life span. Participates in signaling downstream of the angiopoietin receptor TEK/TIE2, and plays a role in the regulation of endothelial cell migration and sprouting angiogenesis. |
Subcellular Location | Cytoplasm.; [Isoform p46Shc]: Mitochondrion matrix. |
Database References | |
Tissue Specificity | Widely expressed. Expressed in neural stem cells but absent in mature neurons. |
Gene Functions References
- Data suggest that up-regulation of SHC threonine phosphorylation is responsible for elevated Akt-signaling and Erk-signaling in triple-negative breast cancer cell lines. PMID: 29208567
- Characterization of bioenergetic parameters and reactive oxygen species production showed that the cellular model of Leigh syndrome is described by increased intracellular oxidative stress and oxidative damage to DNA and proteins, which correlate with increased p66Shc phosphorylation at Ser36. PMID: 28739512
- A positive relationship between the p66Shc expression and oxidative stress was found. p66Shc and oxidative stress were significant predictors of the degree of tubular damage. PMID: 27377870
- Adeno-X Adenoviral System 3 can be used to efficiently construct recombinant adenovirus containing p66Shc gene, and the Adeno-X can inhibit the proliferation of MCF-7 cells by inducing cell cycle arrest at the G2/M phase PMID: 27530145
- STAT4 is a novel transcriptional regulator of p66Shc in normal and chronic lymphocytic leukemia B cells PMID: 27494881
- Isoform b of DDR1 is responsible for collagen I-induced up-regulation of N-cadherin and tyrosine 513 of DDR1b is necessary. PMID: 27605668
- NIC exacerbated AZA-dependent injury via augmenting p66shc transcription. While RES suppressed NIC+AZA-mediated injury, -surprisingly-it further enhanced activity of the p66shc promoter. RES protected cells via the cytoplasmic p66shc/Nrf2/heme oxygenase-1 (HO-1) axis PMID: 28739690
- The results show that the interaction between STS-1 and ShcA is regulated in response to EGF receptor activation. PMID: 28690151
- Nox4-derived H2O2 in part activates Nox2 to increase mitochondrial ROS via pSer36-p66Shc, thereby enhancing VEGFR2 signaling and angiogenesis in endothelial cells. PMID: 28424170
- Data identify, for the first time, a novel non-canonical dynamic mode of interaction between Met and the p66 protein isoform of Shc and its effects on rewiring binding effector complexes according to the activation state of the receptor. PMID: 27048591
- regulates the alternative splicing of XAF1 in extracellular matrix-detachment induced autophagy to coordinate with the anoikic cell death PMID: 26643258
- The silence of p66(Shc) in HCT8 cells reduced the proliferation and accelerated the apoptosis, in addition, the expression of pro-apoptotic proteins caspase-3, caspase-9, Bax was enhanced and the expression of anti-apoptotic protein Bcl-2 was declined. PMID: 26464652
- In mice and humans, reduced p66Shc levels protect from obesity, but not from ectopic fat accumulation, glucose intolerance and insulin resistance. PMID: 26122877
- Data suggest SHC1 (SH2 domain protein C1) expression down-regulates epithelial-mesenchymal transition by repressing TGFB-induced SMAD2/3 activation through differential partitioning of receptors at cell surface of mammocytes/keratinocytes. PMID: 26680585
- p66shc expression in coronary heart disease patients was significantly higher compared with the control group PMID: 24676406
- Finally, a crystal structure of EGFR in complex with a primed Shc1 peptide reveals the structural basis for EGFR substrate specificity. PMID: 26551075
- p53-dependent augmentation of p66(Shc) expression and function represents a key signalling response contributing to beta cell apoptosis under conditions of lipotoxicity PMID: 25810038
- Results show elevated level of p66Shc protein reveal in ovarian cancer cells (OCa) indicating a functional role of the protein in regulating the proliferation of OCa cells. PMID: 24395385
- p66ShcA was upregulated in hearts of patients with ischemic heart disease without heart failure PMID: 25680868
- These data demonstrate that the p52Shc phosphorylation level is altered by the solution environment without affecting the fraction of active c-Src. PMID: 25961473
- Although H2S failed to affect the activities of these two proteins, it disrupted their association. Cysteine-59 resides in proximity to serine-36, the phosphorylation site of p66Shc. PMID: 24766279
- demonstrate that ShcA-dependent activation of AKT, but not the RAS/MAPK pathway, induces VEGF production by bolstering VEGF mRNA translation PMID: 24837366
- the p66shc-dependant ROS production during oxidative stress has mitochondrial origin in human normal and cancer cells. PMID: 24618848
- p66Shc is a bifunctional protein involved in cellular oxidative stress response and differentiation. PMID: 24807908
- High p66Shc expression is associated with malignant gastrointestinal lesions. PMID: 24599562
- CRIF1 knockdown partially induces endothelial activation via increased ROS production and phosphorylation of p66shc PMID: 24906005
- p66(Shc) plays a vital part in canonical Wnt signaling in the endothelium and mediates Wnt3a-stimulated endothelial oxidative stress and dysfunction. PMID: 25147340
- these results identify Grb2 and Shc as central signaling effectors of Met-driven progression of intestinal epithelial-derived cancers. Notably, they suggest that Grb2 may represent a promising target for the design of novel colorectal cancer therapies. PMID: 24708867
- repression of Shc expression by let-7a delays senescence of human diploid fibroblasts. PMID: 24165399
- Study identifies p66ShcA as one of the first prognostic biomarkers for the identification of more aggressive tumors with mesenchymal properties, regardless of molecular subtype. PMID: 25071152
- Serine phosphorylation of p66shc is carried out by active MKK6.beta-Amyloid-induced ROS production and apoptosis increased in the presence of MKK6 and p66shc, which directly associate. PMID: 24085465
- unlike the other isoforms of Shc1, p66Shc appears to antagonize insulin and mTOR signaling, which limits glucose uptake and metabolism. PMID: 24550542
- Exposure of human aortic endothelial cells to stretch led to stretch- and time-dependent p66(Shc) phosphorylation downstream of integrin alpha5beta1 and JNK kinase. In parallel, NADP oxidase and reactive oxygen species increased, and NO bioavailability decreased PMID: 24842918
- study concludes hypercholesterolemia stimulates p66Shc expression in platelets, promoting platelet oxidative stress, hyperreactivity and hyperaggregation via p66Shc PMID: 24845561
- In lung cancer tissues and single cells, p66(Shc) expression inversely correlates with that of Aiolos. PMID: 24823637
- Arg-II promotes mitochondrial dysfunction leading to VSMC senescence/apoptosis through complex positive crosstalk among S6K1-JNK, ERK, p66Shc, and p53, contributing to atherosclerotic vulnerability phenotype. PMID: 23832324
- a central role for adaptor proteins p66Shc and Grb2 in the regulation of ARF1 and ARF6 activation in invasive breast cancer cells. PMID: 24407288
- different domains in SOCS5 contribute to two distinct mechanisms for regulation of cytokine and growth factor signaling with JAK1 and SHC-1 PMID: 23990909
- Salvianolic acid A induced SIRT1 plays an anti-apoptotic role in concanavalin A induced hepatitis by inhibiting p66Shc expression. PMID: 23993977
- p66(Shc) is a good candidate molecule to address the mechanisms underlying healthy aging and to be targeted for the development of novel pharmacological tools for the prevention or cure of age-related pathologies. PMID: 23524280
- DNA methylation of the p66Shc promoter was significantly decreased in the intrauterine growth restricted compared with the appropriate for gestational age infants groups. PMID: 23529764
- Shc plays a pivotal role in coordinately regulating autophagy process and apoptotic resistance in lung adenocarcinoma cells under nutrient-limited conditions. PMID: 23815759
- Knock-down of p66(Shc) leads to a positive feedback upregulation of Nrf2 expression and accordingly, Nrf2 is found to be highly expressed in tumors with low p66(Shc) expression PMID: 23689140
- The p66Shc protein (SHC1 protein) is very important for the regulation of the intracellular redox balance and oxidative stress levels. PMID: 23606925
- Distinct phosphotyrosine-dependent functions of the ShcA adaptor protein are required for transforming growth factor beta (TGFbeta)-induced breast cancer cell migration, invasion, and metastasis PMID: 23277357
- our analysis of human samples demonstrated that enhanced p53/p66Shc signaling plays an important role in the progression of human non-alcoholic fatty liver disease. PMID: 22641095
- Expression of SHC1 mutant protects PC-3 cells against Diallyl trisulfide induced death. PMID: 22020565
- S1P1 expression is controlled by the pro-oxidant activity of p66Shc and is impaired in B-CLL patients with unfavorable prognosis. PMID: 23033271
- Elevated p66Shc expression enhances prostate cancer tumorigenicity. PMID: 22561705
- These findings indicate that LDL cholesterol upregulates human endothelial p66shc expression via hypomethylation of CpG dinucleotides in the p66shc promoter. PMID: 22661506