Biotinylated Recombinant Human Lymphotoxin-Alpha (LTA) Protein (His-Avi)
Biotinylated Recombinant Human Lymphotoxin-Alpha (LTA) Protein (His-Avi)
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Avi-tagged proteins, Biotinylated proteins, Buy cytokines, chemokines, and growth factors for research online, Featured biotinylated protein molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Product Overview
| Description | Biotinylated Recombinant Human Lymphotoxin-Alpha (LTA) Protein (His-Avi) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P01374 |
| Target Symbol | LTA |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | N-6His-Avi |
| Target Protein Sequence | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Expression Range | 35-205aa |
| Protein Length | Partial |
| Mol. Weight | 22.7 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. |
| Subcellular Location | Secreted. Membrane. Note=The homotrimer is secreted. The heterotrimer is membrane-associated. |
| Protein Families | Tumor necrosis factor family |
| Database References | HGNC: 6709 OMIM: 153440 KEGG: hsa:4049 STRING: 9606.ENSP00000403495 UniGene: PMID: 28476335 |
