Biotinylated Recombinant Haemophilus Influenzae Peptidoglycan-Associated Lipoprotein (PAL) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-07326P
Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Haemophilus Influenzae Peptidoglycan-Associated Lipoprotein (PAL) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-07326P
Collections: All products, Avi-tagged proteins, Biotinylated proteins, Featured biotinylated protein molecules, High-quality recombinant proteins, Influenza hemagglutinin (ha) protein: target overview, research applications, and selection guide, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Biotinylated Recombinant Haemophilus Influenzae Peptidoglycan-Associated Lipoprotein (PAL) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P10324 |
| Target Symbol | PAL |
| Species | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Expression System | E.coli |
| Tag | N-MBP&C-6His-Avi |
| Target Protein Sequence | CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY |
| Expression Range | 20-153aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 62.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. |
| Subcellular Location | Cell outer membrane; Lipid-anchor. |
| Protein Families | OmpA family, Pal subfamily |
| Database References | KEGG: hin:HI0381 STRING: 71421.HI0381 |
Gene Functions References
- the conformation of HI0381 is affected by the membrane environment, implying that its folded state is directly related to its function. PMID: 18596413
