Recombinant Human Renin Protein
Beta LifeScience
SKU/CAT #: BLA-7713P
Recombinant Human Renin Protein
Beta LifeScience
SKU/CAT #: BLA-7713P
Collections: Enzymes, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P00797 |
Synonym | Angiotensin forming enzyme Angiotensin forming enzyme precursor Angiotensinogenase Angiotensinogenase precursor FLJ10761 HNFJ2 REN Ren1 RENI_HUMAN Renin Renin precursor renal |
Description | Recombinant Human Renin Protein was expressed in Cell Culture. It is a Full length protein |
Source | Cell Culture |
AA Sequence | LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSK CSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVG GITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQ GVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGV WQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKK RLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAI HAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR |
Molecular Weight | 40 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Conversion to active renin is >99 percent. Prorenin is a glycosylated aspartic protease that consists of 2 homologous lobes and is the precursor of renin. Prorenin exhibits a low level of enzymatic activity relative to renin which is generated from prorenin by proteolytic cleavage of the first ~43 amino acids at the N-terminus. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |