USA  Tel: 1-201-888-7983
Email: info@betalifesci.com

Recombinant Human CD14 Protein

Cat No.: BL-0006PS
CD14 Human Recombinant HEK
Description Related products
tag His
host species Human
synonym Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.
background CD14 (also known lipopolysaccharide (LPS) receptor) is expressed strongly on monocytes and macrophage and weakly on the surface of neutrophils. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a high affinity receptor for complexes of LPS and LPS binding protein (LBP). Soluble CD14, also binding to LPS, acts at physiological concentration as an LPS agonist and has, at higher concentrations, an LPS antagonizing effect in cell activation. CD14 has been shown to bind apoptotic cells.
description CD14 Human Recombinant expressed by mammalian expression system in human cells is a single polypeptide chain containing 341a.a. (20-352). CD14 is fused to an 8a.a. His-tag at C-terminus and purified by unique purification methods.
source HEK293
AA sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH
purity >95% as determined by SDS-PAGE.
endotoxin <1.0 EU per μg by the LAL method.
formulation CD14 was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.
stability Recombinant protein is stable for 12 months at -70℃
usage For Research Use Only
storage Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Online Inquiry
For quote, please fill in the online form or send email to info@betalifesci.com.
$50 Coupon