Recombinant Mouse SLAMF7/CS1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10777P
Recombinant Mouse SLAMF7/CS1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10777P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q8BHK6 |
Synonym | 19A 19A24 protein CD 319 CD2 like receptor activating cytotoxic cells CD2 subset 1 CD319 CD319 antigen CRACC CS1 Membrane protein FOAP 12 Novel Ly9 Novel LY9 (lymphocyte antigen 9) like protein Protein 19A SLAM family member 7 SLAMF 7 |
Description | Recombinant Mouse SLAMF7/CS1 Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQS SNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVY KHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFH DGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSL RG |
Molecular Weight | 28 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Expressed in spleen, lymph node, bone marrow and testis. Lower levels detected in thymus. Expressed in NK cells, B-cells, natural killer cells and activated T-cells. |
Gene Functions References
- phagocytosis of haematopoietic tumour cells during SIRPalpha-CD47 blockade was strictly dependent on SLAM family receptors in vitro and in vivo; in both mouse and human cells, this function required a single SLAM family member, SLAMF7 (also known as CRACC, CS1, CD319), expressed on macrophages and tumour cell targets PMID: 28424516
- CRACC-CRACC interaction between Kupffer and NK cells contributes to poly I:C/D-GalN induced hepatitis. PMID: 24098802
- 2B4, NTB-A and CRACC have roles in the regulation of Natural Killer cell function [review] PMID: 17981603
- CRACC was a critical positive regulator of NK cell function mediated by EAT-2. PMID: 19151721