Recombinant Mouse Metalloproteinase Inhibitor 1 (TIMP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10885P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Metalloproteinase Inhibitor 1 (TIMP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10885P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Metalloproteinase Inhibitor 1 (TIMP1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P12032 |
Target Symbol | TIMP1 |
Synonyms | Timp1; Timp; Timp-1; Metalloproteinase inhibitor 1; Collagenase inhibitor 16C8 fibroblast; Erythroid-potentiating activity; EPA; TPA-S1; TPA-induced protein; Tissue inhibitor of metalloproteinases 1; TIMP-1 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR |
Expression Range | 25-205aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 36.2kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. |
Subcellular Location | Secreted. |
Protein Families | Protease inhibitor I35 (TIMP) family |
Database References | |
Tissue Specificity | Found in fetal and adult tissues. Highest levels are found in bone. Also found in lung, ovary and uterus. |
Gene Functions References
- Study implicated TIMP1, released from the vasculature, as a mediator of the tumorpromoting effects of endothelial PECAM1, thus suggesting its potential role in the progression of metastatic tumors. PMID: 29845213
- miR-138 and ER stress were induced in osteoporosis and then promoted the apoptosis of osteoblasts, at least in part, through TIMP-1. PMID: 29291636
- TIMP-1 is upregulated in liver fibrosis and hepatocellular carcinoma, potentially implying diagnostic relevance in the non-invasive assessment of liver fibrosis or in HCC detection6. However, our study in TIMP-1-deficient mice did not confirm a functional role of TIMP-1 in the development of liver fibrosis or hepatocellular carcinoma. PMID: 28386095
- gingival fibroblasts cell-based therapy is a promising approach to inhibit aneurysm progression and rupture through local production of Timp-1 PMID: 28582477
- These results show that MMP-9/TIMP-1 system disturbance and changes of histological structure in uteri tissue are involved in fluoride-induced reproductive dysfunctions. PMID: 28064417
- Tissue inhibitor of matrix metalloproteinases 1 (TIMP1) inhibition resensitized tumors to gemcitabine and radiotherapy. PMID: 28765154
- proteomic analysis of the mesenchymal stem cells secretome identified the TIMP-1 as a potential effector molecule responsible for the anti-angiogenic properties of MSC PMID: 26898191
- TIMP1 signaling via CD63 leads to activation of hepatic stellate cells, which create an environment in the liver that increases its susceptibility to pancreatic tumor cells. PMID: 27506299
- This study highlights a previously undescribed integral role for TIMP1 in both vascular network maturation and adaptations to ischemia or alterations in flow. PMID: 27430487
- TIMP-1 was identified as a selectively upregulated component secreted from immature astrocytes from human pluripotent stem cells. PMID: 27134175
- demonstrate that TIMP-2 plays a greater protective role than TIMP-1 during the pathogenesis of atherosclerosis PMID: 26645981
- Our findings reveal that elevated levels of TIMP-1 impact on neutrophil homeostasis via signaling through CD63. PMID: 26001794
- TIMP-1 is a ligand of LRP-1 and we highlight a new example of its MMP-independent, cytokine-like functions. PMID: 25075518
- RAB37 regulates the exocytosis of TIMP1 in a nucleotide-dependent manner to inactivate MMP9 migration axis in vitro and in vivo and to suppress tumor metastasis. PMID: 25183545
- PDGF-D intensifies fibrogenesis by interfering with the fibrolytic activity of the TIMP-1/MMP-2/MMP-9 system, and PDGF-D signaling is mediated through both PDGF-alpha and -beta receptors. PMID: 25576870
- Reduced beta(2)GP I plays a role in diabetic mice related to vascular protection, inhibiting vascular lipid deposition, and plaque formation by reducing MMPs/TIMPs expression through down-regulation of the p38MAPK signaling pathway. PMID: 25204377
- Expansion of stem cells counteracts age-related mammary regression in compound Timp1/Timp3-deficient mice. PMID: 25706237
- essential promoter of hepatic premetastatic niche formation PMID: 25131778
- TNF-alpha produced by cholestasis can promote liver fibrosis via TIMP-1 production from hepatic stellate cells. PMID: 23755201
- These data suggest an MMP-independent role of TIMP-1 in regulating CD4 T cell access into the CNS parenchyma during acute JHMV encephalitis PMID: 24156369
- miR-21 contributes to renal fibrosis by mediating MMP9/TIMP1 PMID: 23443810
- Gene expression of Mmp-12 and Mmp-13, and Timp-1 was strongly upregulated at all time points in RD compared with controls. Timp-2, Mmp-2, and Mmp-9 expression was modest. PMID: 24526442
- TIMP-1 protein was detected in synovium. PMID: 24108368
- Acute and chronic elevated laminar shear stress act to maintain vessel integrity through increasing TIMP-1 production, and the TGFbeta signaling pathway is essential to maintain TIMP-1 expression during chronic shear stress. PMID: 24471921
- study provides a unifying molecular mechanism for high angiogenic capacity of TIMP-free proMMP-9 PMID: 24174628
- These observations showed that Serpine-1 and Tissue inhibitor of metalloprotease type-1 did not impact the number of Staphylococcus aures bacteria accumulating at the site of skin infection. PMID: 23776165
- Report TIMP-1 induction in aortic smooth muscle during the development of abdominal aortic aneurysms. PMID: 24279124
- This study suggests that miR-17 participates in the regulation of cardiac matrix remodeling and provides a novel therapeutic approach using miR-17 inhibitors to prevent remodeling and heart failure after MI. PMID: 23825222
- These results not only indicate that TIMP-1 is conducive to HSPC homing; they also identify CD63 and beta1-integrin as a TIMP-1 receptor complex on HSPCs. PMID: 23660069
- Tpl2 is an important signal transducer for TLR activation of gene expression in Kupffer and stellate cells by the ERK pathway and that suppression of its catalytic activity may be a route toward suppressing fibrosis caused by hepatocellular injuries. PMID: 23080298
- Spread of Lewis lung carcinoma cells from serum to the lungs was associated with increased serum content of TIMP-1 and TIMP-2. PMID: 23113307
- Results show enhanced expression and widespread distribution of MMP-2, MMP-9 and their tissue inhibitors TIMP-1 and TIMP-2 in thymus from infected animals. PMID: 23089194
- Inhibition of MMPs by TIMP-1-overexpression results in decreased plaque progression, increased stabilization and decreased plaque rupture complications in murine vein grafts. PMID: 23071737
- NO. Our data support the hypothesis that reduced NO levels leads to the dysregulation of plaque clearance by decreasing the MMP-9/TIMP-1 ratio PMID: 23016931
- We demonstrate that ATP, acting through the P2X7 receptor, induces release of cathepsin B into the extracellular space where it degrades TIMP-1, permitting the MMP-9-dependent migration of glial cells. PMID: 23017058
- presence of the MMP-9/TIMP-1 heterodimers and the activated MMP-9 enzyme in the injured sciatic nerve within the first 24 h post-injury PMID: 22438979
- Results support the use of MMP-9 and TIMP-1 as early biomarkers for the presence and extent of perinatal brain injury in human term newborns. PMID: 22289852
- Results suggest the possible application of IKK2 and Timp-1 inhibitors in treating lung cancer. PMID: 22327365
- Results show that microglia play a central role in regulating glial cell expression of TIMP-1 and -2, and identify microglial IL-1beta as playing a key role in mediating microglial-astrocyte communication. PMID: 21631912
- Overexpression of intracellular tissue inhibitor of metalloproteinase 1 stimulated fibroblast proliferation in a matrix metalloproteinase independent manner by activating the p-Akt pathway and related cell cycle progression PMID: 21350939
- TIMP1 is a negative regulator of adipogenesis. TIMP1 leads to enlarged adipocytes in the state of overnutrition. PMID: 21437772
- A role for TIMP-1 in regulating HSC function, suggesting a novel mechanism presiding over stem cell quiescence in the framework of the bone marrow milieu. PMID: 21521782
- Both MMP-9 and TIMP-1 are highly expressed in Lewis lung cancer, and are correlated to tumor invasion and metastasis. PMID: 19624892
- IL-10, through regulation of the balance between MMPs and TIMP-1, suppresses the foreign body reaction against implanted biomaterials. PMID: 20661871
- these findings describe a previously uncharacterized role for TIMP-1 in the regulation of oligodendrocytes and astrocytes during development and provide a novel function for TIMP-1 on myelination in the developing CNS. PMID: 21508247
- Elevated levels of TIMP-1 in the microenvironment of tumour cells can promote metastasis by inducing HIF-1alpha-dependent HGF-signaling. PMID: 21053058
- Data demonstrate that long-term CNS expression of TIMP1 with complete suppression of gelatinolytic activity does not interfere with physiological brain function. PMID: 20558576
- Data show that leptin regulates MMP-2 and TIMP-1 activity, and collagen synthesis via p38 MAPK in mouse cardiomyocytes. PMID: 20683677
- These results indicate that type 1 diabetes can be prevented by TRAIL overexpression through enhancement of TIMP-1 function. PMID: 21047948
- Data show that wild-type mice had significantly higher levels of SOCS-3 and significantly lower levels of TIMP-1 mRNA and protein than did adiponectin KO mice exposed to both CCl(4) and leptin. PMID: 20564215