Recombinant Mouse ICOS Ligand/ICOSL Protein
Beta LifeScience
SKU/CAT #: BLA-9897P
Recombinant Mouse ICOS Ligand/ICOSL Protein
Beta LifeScience
SKU/CAT #: BLA-9897P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9JHJ8 |
Synonym | B7 H2 B7 homolog 2 B7 homologue 2 B7 like protein Gl50 B7 related protein 1 B7-H2 B7-like protein Gl50 B7-related protein 1 B7H2 B7RP 1 B7RP-1 B7RP1 CD 275 CD275 CD275 antigen GL 50 GL50 ICOS L ICOS LG ICOS ligand ICOSL ICOSL_HUMAN Icoslg Inducible T cell co stimulator ligand KIAA0653 LICOS Transmembrane protein B7 H2 ICOS ligand |
Description | Recombinant Mouse ICOS Ligand/ICOSL Protein was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | TEVGAMVGSNVVLSCIDPHRRHFNLSGLYVYWQIENPEVSVTYYLPYKSP GINVDSSYKNRGHLSLDSMKQGNFSLYLKNVTPQDTQEFTCRVFMNTATE LVKILEEVVRLRVAANFSTPVISTSDSSNPGQERTYTCMSKNGYPEPNLY WINTTDNSLIDTALQNNTVYLNKLGLYDVISTLRLPWTSRGDVLCCVENV ALHQNITSISQAESFTGNNTKNPQETHNNELK |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized human ICOS at 1μg/ml (100μl/well) can bind biotinylated B7-H2 (mouse):Fc (mouse) (rec.) (non-lytic) with a linear range of 0.1-1.0μg/ml. Optimal dilutions should be determined by each laboratory for each application.Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |