Recombinant Mouse BTN1A1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10596P
Recombinant Mouse BTN1A1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10596P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q62556 |
Synonym | BT BT1A1_HUMAN BTN BTN1 Btn1a1 butyrophilin Butyrophilin subfamily 1 member A1 butyrophilin, subfamily 1, member A1 |
Description | Recombinant Mouse BTN1A1 Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | AAPFDVTAPQEPVLALVGSDAELTCGFSPNASSEYMELLWFRQTRSTAVL LYRDGQEQEGQQMTEYRGRATLATAGLLDGRATLLIRDVRVSDQGEYRCL FKDNDDFEEAAVYLKVAAVGSDPQISMTVQENGEMELECTSSGWYPEPQV QWRTGNREMLPSTSESKKHNEEGLFTVAVSMMIRDSSIKNMSCCIQNILL GQGKEVEISLPAPFVPRLTPWHHHHHH |
Molecular Weight | 25 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |