Recombinant Mouse 2B4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10578P
Recombinant Mouse 2B4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10578P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q07763 |
Synonym | 2B4 C9.1 CD244 CD244 antigen CD244 molecule CD244 molecule natural killer cell receptor 2B4 CD244 natural killer cell receptor 2B4 CD244_HUMAN F730046O15Rik h2B4 Ly90 NAIL Natural killer cell activation-inducing ligand Natural killer cell receptor 2B4 NK cell activation inducing ligand NK cell activation inducing ligand NAIL NK cell activation-inducing ligand NK cell type I receptor protein 2B4 NKR2B4 Nmrk Non-MHC restricted killing associated OTTHUMP00000027884 p38 signaling lymphocytic activation molecule 4 SLAM family, member 4 SLAMF4 |
Description | Recombinant Mouse 2B4 Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNW YNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVC NKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRG STLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVP SNHHHHHH |
Molecular Weight | 24 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |