Recombinant Influenza A Hemagglutinin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11428P
Recombinant Influenza A Hemagglutinin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11428P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Influenza A |
Accession | Q0HD60 |
Description | Recombinant Influenza A Hemagglutinin Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPL QLGKCNIAGWILGNPECESLLSKRSWSYIAETPNSENGTCYPGDFADYEE LREQLSSVSSFERFEIFPKERSWPNHNINIGVTAACSHAGKSSFYKNLLW LTEKDGSYPNLNKSYVNKKEKEVLVLWGVHHPSNIENQKTLYRKENAYVS VVSSNYNRRFTPEIAERPKVRGQAGRMNYYWTLLEPGDTIIFEANGNLIA PWYAFALSRGLGSGIITSNASMDECDTKCQTPQGAINSSLPFQNIHPFTI GECPKYVRSTKLRMVTGLRNIPSIQS |
Molecular Weight | 53 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore. |
Subcellular Location | Virion membrane; Single-pass type I membrane protein. Host apical cell membrane; Single-pass type I membrane protein. |
Protein Families | Influenza viruses hemagglutinin family |