Recombinant Human TMIGD2/IGPR1 Protein
Beta LifeScience
SKU/CAT #: BLA-9074P
Recombinant Human TMIGD2/IGPR1 Protein
Beta LifeScience
SKU/CAT #: BLA-9074P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q96BF3 |
Synonym | CD28H IGPR 1 IGPR1 immunoglobulin and proline-rich receptor 1 immunoglobulin-containing and proline-rich receptor 1 TMIG2_HUMAN TMIGD2 Transmembrane and immunoglobulin domain containing 2 Transmembrane and immunoglobulin domain-containing protein 2 transmembrane and immunoglobulin domain-containing protein 2 variant 2 transmembrane and immunoglobulin domain-containing protein 2 variant 3 UNQ3059/PRO9879 |
Description | Recombinant Human TMIGD2/IGPR1 Protein was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYIT NGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELE EAEGNITRLFVDPDDPTQNRNRIASFPGVDHHHHHH |
Molecular Weight | 15 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |