Recombinant Human SLAMF7/CS1 Protein
Beta LifeScience
SKU/CAT #: BLA-10776P
Recombinant Human SLAMF7/CS1 Protein
Beta LifeScience
SKU/CAT #: BLA-10776P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9NQ25 |
Synonym | 19A 19A24 protein CD 319 CD2 like receptor activating cytotoxic cells CD2 subset 1 CD319 CD319 antigen CRACC CS1 Membrane protein FOAP 12 Novel Ly9 Novel LY9 (lymphocyte antigen 9) like protein Protein 19A SLAM family member 7 SLAMF 7 |
Description | Recombinant Human SLAMF7/CS1 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIV TQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVL HVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAAN ESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDP DSSVDHHHHHH |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Please see notes section. |
Target Details
Target Function | Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines.; Isoform 3 does not mediate any NK cell activation. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-cell lines. Expressed |
Gene Functions References
- Memory CD8+ T cells from SLE patients displayed decreased amounts of SLAMF7, a surface receptor that characterizes effector CD8+ T cells. Ligation of SLAMF7 increased CD8+ T cell degranulation capacity and the percentage of IFNgamma-producing cells in response to antigen challenge in SLE patients and healthy controls. SLAMF7 engagement promoted cytotoxic lysis of target cells in response to stimulation with viral antig... PMID: 28076903
- phagocytosis of haematopoietic tumour cells during SIRPalpha-CD47 blockade was strictly dependent on SLAM family receptors in vitro and in vivo; in both mouse and human cells, this function required a single SLAM family member, SLAMF7 (also known as CRACC, CS1, CD319), expressed on macrophages and tumour cell targets PMID: 28424516
- Cohort statistics revealed a significant increase of circulating sSLAMF7 in multiple myeloma patients versus normal controls PMID: 27116021
- Blimp-1 regulates the transcription of CS1 gene in NK and B cell lines from multiple myeloma and diffuse large B cell lymphoma patients. PMID: 26310579
- SLAMF7-triggered inhibition is mediated by a mechanism involving Src kinases, CD45, and SHIP-1 that is defective in MM cells PMID: 25312647
- Our data highlight the therapeutic potential of targeting CD319 in rheumatoid arthritis PMID: 24299175
- SLAMF7 plays an inhibitory role in human monocytes to control proinflammatory immune responses. PMID: 23695528
- These results suggest a role for CD319 and CD229 in the systemic lupus erythematosus disease process. PMID: 23956418
- These data suggest an involvement of CRACC-mediated NK cell activation in periodontal tissue destruction and point to a plausible distinction in the pathobiology of aggressive and chronic periodontitis. PMID: 23250953
- CS1-L and CS1-S may differentially regulate human NK cell functions PMID: 15368295
- CS1 may play a role in the regulation of B lymphocyte proliferation during immune responses PMID: 17878365
- CS1 was expressed at adhesion-promoting uropod membranes of polarized Multiple Myeloma cells, andis required for MM cell adhesion to bone marrow stromal cells PMID: 17906076
- HuLuc63 eliminates myeloma cells, at least in part, via NK-mediated ADCC and shows the therapeutic potential of targeting CS1 with HuLuc63 for the treatment of multiple myeloma. PMID: 18451245