Recombinant Human Robo1 Protein
Beta LifeScience
SKU/CAT #: BLA-7853P
Recombinant Human Robo1 Protein
Beta LifeScience
SKU/CAT #: BLA-7853P
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9Y6N7 |
Synonym | Deleted in U twenty twenty DUTT 1 DUTT1 FLJ21882 H Robo 1 H-Robo-1 hRobo 1 Robo 1 Robo1 ROBO1_HUMAN Roundabout 1 Roundabout axon guidance receptor homolog 1 Roundabout homolog 1 Roundabout homolog1 precurser Roundabout1 SAX 3 SAX3 |
Description | Recombinant Human Robo1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYI EVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |