Recombinant Human PVRL1/NECTIN1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-7493P
Recombinant Human PVRL1/NECTIN1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-7493P
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q15223 |
Synonym | CD111 CD111 antigen CLPED1 ectodermal dysplasia 4 (Margarita Island type) ED4 Herpes virus entry mediator C Herpesvirus entry mediator C Herpesvirus Ig like receptor Herpesvirus Ig-like receptor HIgR HveC MGC142031 Nectin 1 Nectin-1 OFC7 OROFACIAL CLEFT 7 OTTHUMP00000232093 OTTHUMP00000232094 OTTHUMP00000232095 Poliovirus receptor related protein 1 poliovirus receptor-like 1 Poliovirus receptor-related protein 1 PRR PRR1 PVRL 1 PVRL1 PVRL1_HUMAN PVRR PVRR1 SK-12 |
Description | Recombinant Human PVRL1/NECTIN1 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment |
Source | Baculovirus infected insect cells |
AA Sequence | ADPQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQN VAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFA TFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANG KPPSVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACI VNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPA TEYHWTTLNGSLPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSG QVEVNITEFPYTPSPPEHGRRAGPVPTAHHHHHH |
Molecular Weight | 37 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |