Recombinant Human PVRL1/NECTIN1 Protein
Beta LifeScience
SKU/CAT #: BLA-7492P
Recombinant Human PVRL1/NECTIN1 Protein
Beta LifeScience
SKU/CAT #: BLA-7492P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q15223 |
Synonym | CD111 CD111 antigen CLPED1 ectodermal dysplasia 4 (Margarita Island type) ED4 Herpes virus entry mediator C Herpesvirus entry mediator C Herpesvirus Ig like receptor Herpesvirus Ig-like receptor HIgR HveC MGC142031 Nectin 1 Nectin-1 OFC7 OROFACIAL CLEFT 7 OTTHUMP00000232093 OTTHUMP00000232094 OTTHUMP00000232095 Poliovirus receptor related protein 1 poliovirus receptor-like 1 Poliovirus receptor-related protein 1 PRR PRR1 PVRL 1 PVRL1 PVRL1_HUMAN PVRR PVRR1 SK-12 |
Description | Recombinant Human PVRL1/NECTIN1 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | QVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAI YNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFP TGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPP SVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNY HMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEY HWTTLNGSLPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVE VNITVDHHHHHH |
Molecular Weight | 35 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. After reconstitution store at -20°C. Avoid freeze / thaw cycle. |