Recombinant Human Proteoglycan 4 (PRG4) Protein (His&Myc)

Name: Recombinant Human Proteoglycan 4 (PRG4) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-04996P
Price: 240.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Back to school. back to lab. ready for results. - advance your research with beta lifescience, High-quality recombinant proteins, In-stock recombinant proteins, Other recombinant proteins

Price Save $1,164

Size

100ug

Quantity

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Proteoglycan 4 (PRG4) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q92954
Target Symbol	PRG4
Synonyms	PRG4; MSF; SZP; Proteoglycan 4; Lubricin; Megakaryocyte-stimulating factor; Superficial zone proteoglycan) [Cleaved into: Proteoglycan 4 C-terminal part]
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-10His&C-Myc
Target Protein Sequence	QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE
Expression Range	25-156aa
Protein Length	Partial
Mol. Weight	18.6 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.; Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.
Subcellular Location	Secreted.
Database References	HGNC: 9364 OMIM: 208250 KEGG: hsa:10216 STRING: 9606.ENSP00000399679 UniGene: PMID: 29683034 Intra-articular injection of human PRG4 in vivo in Prg4-/- mice prevented caspase-3 activation in superficial zone chondrocytes and was associated with a modest decrease in whole joint friction. PMID: 28604608 PRG4 plays an important anti-inflammatory role in regulating osteoarthritis synoviocyte proliferation. PMID: 28482921 IL6 and PRG4 represent potential novel tissue biomarkers of disease severity and prognosis in conjunctival fibrosis after glaucoma surgery. PMID: 28975281 adult talar cartilage increases both PRG4 release and biosynthetic activity as immediate cellular response to injury PMID: 27551813 Double knockdown of PRG4 and IL-24 did not inhibit myxoid liposarcoma (MLS)- cell growth, and single knockdown of PRG4 remarkably increased IL-24 expression. These results suggest that the growth inhibitory effect of PRG4 knockdown is caused by induction of IL-24 expression, and PRG4 may contribute to maintain MLS cell growth through repression of IL-24 expression. PMID: 28192118 lubricin expression may typify adaptive and neoplastic changes along a pathway toward fibroblast-like synoviocytes PMID: 26924731 PRG4 binds to TLR2 and TLR4 and this binding mediates a novel anti-inflammatory role for PRG4. PMID: 26643105 Cartilage derived from MSCs expressed lubricin protein both in vitro and in vivo PMID: 26867127 no synovial fluid level differences detected between healthy knees and injured knees PMID: 26037740 The finding that rhPRG4 can increase the viscosity of low concentration HA solutions suggests that supplementation with rhPRG4 may help mitigate the loss in synovial fluid viscosity experienced with decreased HA concentration in osteoarthritis. PMID: 25818000 PRG4 is a novel putative ligand for CD44 and may control synoviocyte overgrowth in inflammatory arthropathies via a CD44-mediated mechanism. PMID: 25708025 The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, has been identified by site-specific glycopeptide analysis. PMID: 25187573 Lubricin (Prg4) plays a role in preventing damage to the superficial zone and preservation of chondrocytes. [Review] PMID: 25172828 5 novel PRG4 mutations and the first case of CACP syndrome resulting from uniparental disomy of chromosome 1. PMID: 23756439 We speculate that an important role of lubricin in mediating interactions at the cartilage surface is to attach to the cartilage surface and provide a protective coating that maintains the contacting surfaces in a sterically repulsive state. PMID: 24406099 Lubricin is transcribed, translated, and expressed by ocular surface epithelia. Lubricin presence significantly reduces friction between the cornea and conjunctiva. PMID: 23599181 The objective was to evaluate the presence and distribution of the lubricating and anti-adhesion glycoprotein lubricin and cells containing the contractile isoform smooth muscle alpha-actin (SMA) in pseudomembranes around loose hip prostheses. PMID: 23174700 the identification of a novel null mutation in PRG4 confirming the genetic homogeneity of Camptodactyly-arthropathy-coxa vara-pericarditis syndrome . PMID: 22678705 Production and accumulation of the superficial zone protein (SZP), also known as lubricin, by the surface zone is a characteristic feature of articular cartilage. PMID: 22490392 Lubricin in human breast tissue expander capsules PMID: 22865664 lubricin is able to bind to PMN via an L-selectin-dependent and -independent manner and may play a role in PMN-mediated inflammation. PMID: 22930755 lubricin is expressed in the TMJ disc bilaminar zone; lubricin may have a role in normal disc posterior attachment physiology through the prevention of cellular adhesion as well as providing lubrication during normal bilaminar zone function PMID: 21955422 Lubricin is expressed in chondrocytes derived from osteoarthritic cartilage encapsulated in poly (ethylene glycol) diacrylate scaffold. PMID: 22073377 The surface layer of lubricin coating torn edges of anterior cruciate ligaments and menisci may interfere with the integrative healing process needed for repair. PMID: 21647956 We described a 2-bp novel deletion mutation in PRG4 gene in a Pakistani family with camptodactyly-arthropathy-coxa-vara-pericarditis syndrome PMID: 21565623 O-linked oligosaccharides NeuAc alpha2-3Gal beta1-3GalNAc and NeuAc alpha2-3Gal beta1-3(NeuAc alpha2-6)GalNAc were the dominating structures on lubricin. The latter was more prevalent in rheumatoid arthritis, indicating that sialylation is up-regulated. PMID: 20443780 HAPO enhanced total adherence of HUVEC in a concentration-dependent manner. PMID: 19900364 Mrna present in tendons from tennis elbow. PRG4 may also be expressed as alternatively spliced form lacking exons which encode part of the N-terminal matrix-binding and cell-proliferative domain. PMID: 12475643 Megakaryocyte stimulating factor (msf) is linked to prosthetic loosening. PMID: 12783322 data suggest that HAPO is a novel growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages [HAPO] PMID: 14976050 hemangiopoietin is encoded by HAPO, also known as CACP, MSF, SZP, and PRG4 [editorial] PMID: 15710563 Results describe the production of antibodies against human lubricin to determine the consequence of disease-causing mutations at the protein level and to study the protein's normal post-translational processing. PMID: 16000300 PRG4 mutations may have a role camptodactyly-arthropathy-coxa vara-pericarditis in Saudi families PMID: 16429407 In the human knee, cartilaginous deposits and osteoarthritic cartilage contained PRG4 in patients with advanced knee osteoarthritis. PMID: 17343281 Lubricin provides synovial fluid with an ability to dissipate strain energy induced by mammalian locomotion, which is a chondroprotective feature that is distinct from boundary lubrication. PMID: 17404241 synovial fluid lubricin concentrations were significantly reduced at an early stage following anterior cruciate ligament injury when compared with those in the contralateral joint. PMID: 18512776 These findings demonstrate that HAPO induces endothelial cell proliferation through the PI-3K/Akt pathway. PMID: 18769058 findings point to two distinct mechanisms by which rh-lubricin lubricates, one mechanism involving lubricin bound to the tissue surface and the other involving lubricin in solution PMID: 19058183

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.