Recombinant Human PLCD4 Protein
Beta LifeScience
SKU/CAT #: BLA-7102P
Recombinant Human PLCD4 Protein
Beta LifeScience
SKU/CAT #: BLA-7102P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase delta 4 1-phosphatidylinositol 4 1-phosphatidylinositol-4 5-bisphosphate phosphodiesterase delta-4 hPLCD4 MGC12837 Phosphoinositide phospholipase C delta 4 Phosphoinositide phospholipase C-delta-4 Phospholipase C delta 4 Phospholipase C-delta-4 PLC delta 4 PLC delta4 PLC-delta-4 PLCD4 PLCD4_HUMAN |
Description | Recombinant Human PLCD4 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | MQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVE TIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMR GLQLLVDLVT |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |