Recombinant Human Placenta-Specific Protein 1 (PLAC1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-01793P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Placenta-Specific Protein 1 (PLAC1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-01793P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Placenta-Specific Protein 1 (PLAC1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9HBJ0
Target Symbol PLAC1
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM
Expression Range 23-212aa
Protein Length Full Length of Mature Protein
Mol. Weight 23.3 kDa
Research Area Developmental Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function May play a role in placental development.
Subcellular Location Secreted.
Protein Families PLAC1 family
Database References

HGNC: 9044

OMIM: 300296

KEGG: hsa:10761

STRING: 9606.ENSP00000352173

UniGene: PMID: 29532882

  • Screening for these five CTAs and PLAC1 by RTqPCR may offer a potentially valuable prognostic tool with good sensitivity and specificity in patients with Hepatocellular carcinoma (HCC) that may be enhanced by magneticactivated cell sorting . PMID: 28849093
  • Study revealed that PLAC1 expression was highly expressed in non-small cell lung cancer (NSCLC) tissues, suggesting that PLAC1 may be a prognostic factor and higher risk for NSCLC patients. PLAC1 was involved in regulation of the proliferation, migration, and invasion abilities of NSCLC cells partly through regulation of epithelial-mesenchymal transition and the AKT pathway. PMID: 29138842
  • There was no significant correlation of serum PLAC1 levels with race, age at diagnosis, body mass index (BMI) or the presence of metastatic disease. It remains to be determined whether PLAC1 serum levels can serve as a diagnostic biomarker for the presence or recurrence of disease post-surgery and/or therapy PMID: 29432428
  • this paper shows that PLAC1 immunization does not induce infertility in mice PMID: 28351180
  • Optimized protocol for soluble prokaryotic expression, purification and structural analysis of human placenta specific-1(PLAC1). PMID: 28315746
  • we show that PLAC1 transcript number is significantly negatively correlated with patient survival in our samples. Thus, we suggest that characterizing tumors for TP53 mutation status, p53 protein status and PLAC1 transcription could be used to predict likely prognosis and inform treatment options in patients diagnosed with serous ovarian cancer. PMID: 28339050
  • This study demonstrated that the protein expression of PLAC1 was significantly associated with decreased overall survival in patients with pancreatic ductal adenocarcinoma, indicating that it was a valuable prognostic marker for pancreatic ductal adenocarcinoma and might be a potential target for immunotherapy. PMID: 28618924
  • Plac1 plays a pivotal role in the progression of HCC, and may serve as a novel therapeutic target for Hepatocellular carcinoma. PMID: 27878289
  • PLAC1 was mainly expressed in the human villous syncytiotrophoblast (STB) layer throughout gestation, and the expression level of PLAC1 was significantly elevated during human trophoblast syncytialization. PMID: 27692364
  • PLAC1/CP1 provides a marker for identifying gastric cancers with poor prognosis, and suggest that PLAC1/CP1 may provide a useful target for immunotherapy. PMID: 26157147
  • circulating mRNA improved detection rate of pre-eclampsia PMID: 25138310
  • Data suggests that PLAC1 plays an important role in human placental trophoblast invasion and migration. PMID: 24989904
  • This data suggests that the Epstein-Barr virus-induced PLAC1 is a member of the cancer/testis group of tumor antigens. PMID: 24912876
  • PLAC1/CP1 antigen is a possible prognostic marker of colorectal carcinoma, and PLAC1/CP1 p41-50 and PLAC1/CP1 p69-77 are novel HLA-A*0201-restricted CD8+ T cell epitopes PMID: 23604623
  • NCOA3 is a selective co-activator of estrogen receptor alpha-mediated transactivation of PLAC1. PMID: 24304549
  • we identified a novel specific antitrophoblast antibody, anti-PLAC1, in infertile women with repeated unexplained implantation failure. PLAC1 shows placenta-specific expression and is localized primarily in the syncytiotrophoblast. PMID: 23434395
  • A novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 has been identified in breast cancer. PMID: 21710262
  • The expression of PLAC1/CP1 genes correlates with various clinical and pathologic parameters in primary colorectal carcinoma. PMID: 21215095
  • A potential role for PLAC1 as a biomarker predictive of specific pregnancy complications, such as preeclampsia. PMID: 20509147
  • PLAC1, a trophoblast-specific gene, is Trophoblast-specific expression throughout gestation and responsiveness to KGF are consistent with a fundamental role for PLAC1 at the maternal-fetal interface. PMID: 12412044
  • mRNA transcripts from placenta-expressed specific gene are detectable in maternal blood and rapidly disappear after delivery PMID: 15608456
  • PLAC1 expression is upregulated during trophoblast differentiation, localizing primarily to the differentiated syncytiotrophoblast. PMID: 15803460
  • Plasma PLAC1 and glial cells-missing 1 mRNAs appear promising as noninvasively measurable molecular markers for pre-eclampsia PMID: 16594548
  • In induced term pregnancies, PLAC1 mRNA in maternal blood at the beginning of the treatment correlates with time elapsed before delivery; this demonstrates that fetomaternal trafficking of nucleic acids is more consistent when labor is about to begin. PMID: 16860456
  • Data show that PLAC1 is restricted primarily to the differentiated trophoblast, localizing to intracellular membranous compartment(s) in the apical region of the syncytiotrophoblast and associated with its apical, microvillous membrane surface. PMID: 17186554
  • CRH, PLAC1, and selectin-P are distributed differently in preeclampsia cases compared to controls and correlate with signs of preeclampsia. PMID: 17554801
  • RNAi-mediated silencing of PLAC1 in MCF-7 and BT-549 breast cancer cells profoundly impairs motility, migration, and invasion and induces a G1-S cell cycle block with nearly complete abrogation of proliferation. PMID: 17909063
  • study demonstrated that PLAC1 is a novel tumor antigen with very restricted normal tissue expression; also evidence provided that PLAC1 is expressed in the tumor cells in a subset of lung cancer patients PMID: 17983203
  • 3.8% (4/101) of HCC patients had anti-PLAC1 antibody response, suggesting the immunogenicity of PLAC1 in HCC patients. PLAC1 represents a new class of tumor associated antigen with restricted expression in placenta and cancer tissues. PMID: 18183594
  • analysis of activation of trophoblast-specific PLAC1 in breast cancer by CCAAT/enhancer-binding protein beta (C/EBPbeta) isoform 2 PMID: 19652226
  • In normal tissues, PLAC1 expression was restricted to the placenta while developmental pluripotency associated-2 expression was restricted to the placenta and testis. PMID: 19705800
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed