Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10893P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10893P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His) is produced by our Yeast expression system. This is a extracellular protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P12319
Target Symbol FCER1A
Synonyms Fc epsilon RI alpha; Fc epsilon RI alpha chain ; Fc epsilon RI alpha-chain; Fc fragment of IgE high affinity I receptor for alpha polypeptide; Fc fragment of IgE; high affinity I; receptor for; alpha subunit; Fc fragment of IgE; high affinity I; receptor for; alpha polypeptide; Fc IgE receptor alpha polypeptide; Fc IgE receptor; alpha chain; Fc IgE receptor; alpha polypeptide; Fc of IgE high affinity I receptor for alpha polypeptide; Fc-epsilon RI-alpha; FCE 1A; FCE1A; FCER 1A; Fcer1a; FCERA_HUMAN; FceRI alpha; FcERI; high affinity IgE receptor; High affinity immunoglobulin epsilon receptor alpha subunit; high affinity immunoglobulin epsilon receptor alpha-subunit; High affinity immunoglobulin epsilon receptor subunit alpha; IgE Fc receptor alpha subunit; IgE Fc receptor subunit alpha; Immunoglobulin E receptor high affinity of mast cells alpha polypeptide ; immunoglobulin E receptor; high-affinity; of mast cells; alpha polypeptide
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
Expression Range 26-205aa
Protein Length Extracellular Domain
Mol. Weight 23.0kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location Cell membrane; Single-pass type I membrane protein.
Database References

Gene Functions References

  1. Patient stratification revealed a significant association (P < 0.05) of rs2427827 SNP with high IgE level Chronic Rhinosinusitis with Nasal Polyposis (CRSwNP) patients. Nonetheless, we found no SNP associated with low serum IgE level patients. SNP (rs2427827) in the FcvarepsilonR1alpha gene region and high IgE levels may confer susceptibility to CRSwNP in north Indian population. PMID: 29243845
  2. Data show that each IgE Fc is targeted by two single-domain antibodies (sdabs) having an epitope largely distinct from the FcepsilonRI binding site but overlapping significantly with the CD23-binding site. PMID: 29295972
  3. Autoreactive CD4(+) T cells that target FcepsilonRIalpha were detected in most subjects with chronic spontaneous urticaria, with a cytokine secretion profile more typical of a TH1-cell response. Our findings suggest that measurement of T-cell as well as autoantibody responses to FcepsilonRIalpha could improve diagnostic accuracy in subjects with chronic spontaneous urticaria . PMID: 27417022
  4. Our results suggest that IL13 rs20541, IL4 rs2243250, ADRB2 rs1042713, and FCER1B rs569108, four SNPs with significant sole effect on asthma, interact to confer a higher risk for the disease in Chinese Han children. PMID: 26613553
  5. F-AFE containing anti-allergic phytochemicals, including arctigenin, inhibited the activation of the FceRI receptor induced by the antigenIgE complex PMID: 26707911
  6. IgG2 and IgG3 are involved in recruiting CD32 to inhibit activation of FcepsilonRI in human basophils. PMID: 26774660
  7. Asthmatics with reduced lung function had a higher frequency of Lin(-) CD34(hi) CD117(int/hi) Fc epsilon RI(+) blood mast cell progenitors than asthmatics with normal lung function. PMID: 26626992
  8. SNPs of FcepsilonR1alpha promoter region may be used as disease markers for IgE-mediated allergic inflammation caused by Dermatophagoides pteronyssinus. PMID: 25923080
  9. FcepsilonRI alpha-chain is an activating platelet endothelium aggregation receptor 1 (PEAR1) ligand. PMID: 25713122
  10. Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation PMID: 26136426
  11. These data suggest that rs2298805 might be associated with risk for Chronic urticaria and the therapeutic efficacy of nonsedating H1-antihistamines in Chinese patients PMID: 25412950
  12. FCER2 polymorphism rs3760687 affects moderately elevated total serum IgE levels, especially in the absence of homozygosity for the risk allele of FCER1A SNP rs2427837. PMID: 24354852
  13. Data indicate that antigen (Ag) targeting to FcepsilonRI inhibits the development of Ag-specific T cell immunity and induces T cell tolerance. PMID: 24610015
  14. FCER1A expressing dendritic cells and monocytes but not basophils, significantly contribute to serum hIgE clearance. PMID: 24569373
  15. elevated levels of surface-bound proteins on cord blood basophils is associated with maternal allergy PMID: 23980848
  16. Genetic polymorphism is associated with IgE levels in asthmatics in Germany PMID: 23725541
  17. Overexpression of miR-142-3p enhances FcepsilonRI-mediated degranulation. PMID: 24361879
  18. We assayed the genotype and allele frequencies of rs2298804 (251 A>G) in the FCER1A gene, in patients with Systemic Lupus Erythematosus in a Chinese Han population and found a significant difference for both the AG genotype and the G allele PMID: 23621092
  19. no association between SNP in the FCER1A gene region and serum total IgE level in Chinese allergic rhinitis patients PMID: 22800345
  20. Expression of high-affinity IgE receptor on human peripheral blood dendritic cells in children PMID: 22384272
  21. Mutation in IgE receptor is associated with mast-cell leukemia. PMID: 22173243
  22. Linkage disequilibrium and the distribution of haplotypes for two identified human FCER1A 3'-UTR polymorphisms and several previously reported 5'-flanking region and 5'-UTR variants in Japanese and Poles, is described. PMID: 21725845
  23. genetic polymorphisms in the promoter region is associated with atopic dermatitis in a Han Chinese population PMID: 22222815
  24. increased FcepsilonRI expression on alveolar mast cells is a novel disease-specific feature of allergic asthma. PMID: 21958156
  25. Data show that the developed method allows for comparative analysis of sFcepsilonRI levels in health and disease. PMID: 21903095
  26. There were no significant relationships between FcepsilonRI and atopic dermatitis, although there were trends towards an association between the 66T>C (rs2251746) polymorphism and total serum IgE levels. PMID: 21738338
  27. FcepsilonRI transgene on dendritic cells drives the cascade of pathogenic reactions linking the initial allergen capture by IgE with subsequent T helper (Th)2-dominated T cell responses and the development of late-phase allergic tissue inflammation. PMID: 21622859
  28. The crystal structure of IgE bound to FcepsilonRI is determined. PMID: 21516097
  29. SNPs in the FCER1A gene region show no association with allergic rhinitis in a Han Chinese population PMID: 21209833
  30. Data indicate that although results rather show the lack of an association between FCER1A rs41264475 mutation and atopic dermatitis, they suggest that its minor allele can predispose to the concomitant asthma in AD patients. PMID: 21216468
  31. The ability of four synthetic and sequence-specific RNA interfering antisense oligodeoxynucleotides (AS-ODNs) to reduce the expression of FcepsilonRIalpha gene in granulocytes of allergy sufferers in vitro, was investigated. PMID: 19697153
  32. Secretagogue stimulation results in an increase in the immature p46 form of FcepsilonRIalpha due to reversal of degradative pathways rather than increased synthesis of FcepsilonRIalpha. PMID: 20664273
  33. FCER1A variants by themselves and in combination influence IgE levels and act synergistically to influence eczema risk. PMID: 20028371
  34. Data suggest a contribution of Fc epsilonRI alpha and gamma chains either to immunosurveillance or pathophysiology of the intestinal epithelium. PMID: 20126404
  35. FcRIalpha gene variants are involved in the pathogenesis of IBD. PMID: 20163202
  36. Data show that atopic dermatitis patients with the FCER1A -315CT/TT genotype tended to have higher total serum IgE levels. PMID: 20141544
  37. Glucose can augment Fc epsilon RI-mediated mast cell activation, particularly the degranulation response and LTC(4) secretion after prolonged culture of mast cells with high-glucose medium. PMID: 20523060
  38. counterregulation of FcepsilonRI and TLR-7 pathways exists in Plasmacytoid dendritic cells PMID: 20410486
  39. genetic polymorphismn, mutational screening and asthma association studies; review PMID: 18726713
  40. SP downregulated expression of FcepsilonRI in a concentration dependent manner; the effect was mediated by the neurokinin-1 receptor and resulted in reduced mast cell activation. PMID: 20117843
  41. Expression of FcepsilonRI was significantly elevated on respiratory tract dendritic cells (RTDC) from atopic as compared to nonatopic patients. PMID: 19385959
  42. homozygosity for the C allele of FcepsilonRI alpha chain variant is associated with lower IgE levels PMID: 12070183
  43. Regulation of FcepsilonRI-mediated degranulation by an adaptor protein 3BP2 in rat basophilic leukemia RBL-2H3 cells. PMID: 12200378
  44. Transcriptional regulation of the high affinity IgE receptor alpha-chain gene. PMID: 12217383
  45. Efficient folding of the FcepsilonRI alpha-chain membrane-proximal domain D2 depends on the presence of the N-terminal domain D1. PMID: 12270716
  46. mast cells modulate the immune system following TLR4-mediated activation and FcepsilonRI aggregation PMID: 12855579
  47. In clinically uninvolved skin, Langerhans' cell-surface Fc epsilon RI expression is not only linked to atopic dermatitis but is also generally associated with allergic disease. PMID: 12897750
  48. T/C polymorphism in Fc epsilon RI alpha-chain promoter at nucleotide position -66 is associated with allergic diseases in a Japanese population. PMID: 12902495
  49. Fc epsilon RI-mediated calcium flux (dependent on PLC gamma 1) leads to degranulation of mast cells independent of PI 3-kinase PMID: 13129935
  50. Results indicate that interleukin-4, together with recombinant human stem cell factor, can induce T cell maturation from cord blood progenitor cells, and that IL-4 increased the expression of FcepsilonRI on fetal liver mast cells. PMID: 14746805

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed